Pricing
Sign Up
Log in
Vexels Logo

250 sport adventure designs graphics for t-shirt and print on demand merch

Download sport adventure t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.
Sponsored results byShutterstock Logo
Get 15% off with code: VXL15

Adventure awaits beyond the horizon PNG Design

Premiumcrown icon
A breathtaking sunset over a calm ocean, with hues of orange and pink painting the sky, promising adventures beyond the distant horizon

Mountain bike sport t-shirt design

for Mercht-shirt icon
Dynamic t-shirt design showing a mountain biker with the text: "Adrenaline is my life"

E biking adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Check out this cool t-shirt design for electronic bikers including a man riding his bike through the forest and the German quote 'Yes, everything's alright'

Paragliding avdenture sport t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Awesome t-shirt design featuring a person paragliding and the quote "Speedflying let's shred"

Live on tape tight rope t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Look at this cool t-shirt design for tight rope fans including a person's silhouette in a retro sunset background and the quote 'Live on tape'
Edit Online BadgeEdit Online

Playful dog canoeing adventure illustration t-shirt design template

Charming t-shirt design featuring a playful dog paddling in a canoe

Stand-up paddleboarding woman t-shirt design

for Mercht-shirt icon
Monochrome t-shirt design of a woman with a stand-up paddleboard, ideal for aquatic sports enthusiasts and adventurers

Mountain biking adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Striking t-shirt design with a mountain biker against a backdrop of towering mountains and the phrase "Mountains are calling

Sand in my boots hiking t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Check out this cool t-shirt design for people who loves hiking including the quote 'All I brought back with me was sand in my boots'

Summer beach umbrella t-shirt design

for Mercht-shirt icon
Editable text
Print ready
This playful t-shirt design features a beach umbrella with a striking striped pattern in red and white

Exciting basketball adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Playful t-shirt design with a smiling basketball

Adventure sports zipline design PNG Design

Premiumcrown icon
Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Bigfoot skiing adventure t-shirt design

for Mercht-shirt icon
Humorous t-shirt design showing a cartoon Bigfoot skiing downhill, blending cryptozoology with winter sports
Edit Online BadgeEdit Online

Playful yeti snowboard design t-shirt design template

Bold graphic t-shirt design featuring a playful yeti character holding a snowboard

Slackline sport silhouette PNG Design

Premiumcrown icon
Slackline sport silhouette
Edit Online BadgeEdit Online

Playful helmet design with cherry motif and motivational quotes t-shirt design template

Whimsical helmet design featuring a cherry as the focal point, ideal for sports enthusiasts
Edit Online BadgeEdit Online

Dynamic racing quote design t-shirt design template

Bold t-shirt design featuring a high-energy racing car mid-jump

Line icon of a snowboarder riding a wave PNG Design

Premiumcrown icon
A black and white line icon showcasing a snowboarder skillfully riding a snowy wave, capturing the essence of winter sports and adventure

Detailed four-wheeler quad bike illustration PNG Design

Premiumcrown icon
Dynamic and bold, this poster design features a striking illustration of a four-wheeler quad bike
Edit Online BadgeEdit Online

Vintage montana clothing logo design with inspirational quote t-shirt design template

Charming apparel design featuring the word 'Montana' prominently displayed in a bold arch

Yeti Santa Claus snowboarding adventure t-shirt design

for Mercht-shirt icon
Print ready
Eye-catching t-shirt design featuring a Yeti Santa Claus having a blast while snowboarding

Cliff jumping t-shirt design

Premiumcrown icon
Editable text
Print ready
Dynamic t-shirt design with the text 'Cliff Jumping' over a stark cliff seascape, capturing the thrill of the sport

Climbing silhouette t-shirt design

for Mercht-shirt icon
Print ready
Dynamic t-shirt design featuring a climber scaling a wall, accentuated by a light effect

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Cross country adventurer graphic design PNG Design

Bold t-shirt design featuring the text 'Cross Country Adventurer' in striking typography

Paragliding sunset t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design that features a person paragliding during the sunset
Edit Online BadgeEdit Online

Fierce tiger illustration with unleash quote t-shirt design template

Dynamic t-shirt design featuring a roaring tiger and the quote 'Unleash Your Inner Beast' along with the year 1960

Racing quad bike black PNG Design

Racing quad bike black

Flat water sports surf creator

Editable design featuring tons of different water sports silhouettes and backgrounds to choose from

Hiking tracking log template KDP interior design

for Mercht-shirt icon
Print ready
Cool hiking themed tracking log

Girl climbing a rock wall PNG Design

Premiumcrown icon
A determined girl scaling a towering rock wall, gripping the handholds tightly as she moves upward with confidence and focus

Adventure climbing illustration with sunset and ocean PNG Design

Premiumcrown icon
Dynamic sticker design featuring a climber on a rock against a sunset backdrop, embodying outdoor adventure

Mountain Climber Adventure Lifestyle T-shirt Design

for Mercht-shirt icon
Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Stylized shield design with vibrant sunset and claw marks for sports branding PNG Design

Premiumcrown icon
Striking logo design featuring a shield shape, claw marks, and a central sun motif

Mountain climbing adventure graphic design PNG Design

Premiumcrown icon
Dynamic climbing graphic design featuring a silhouetted climber against a scenic backdrop
Edit Online BadgeEdit Online

Vintage mountain escape ski poster design t-shirt design template

Charming vintage poster design featuring a female skier ready for adventure

Playful skiing dog illustration PNG Design

Premiumcrown icon
Charming and whimsical, this illustration features a skier being joyfully pulled by a playful dog

Motorcycle with gears PNG Design

Premiumcrown icon
A sleek black motorcycle with gears, ready to hit the road and speed through the streets with power and precision

French accounting book cover design

Premiumcrown icon
Editable text
Print ready
Cool book cover design featuring geometrical diamond shapes

Paraglider t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design consisting of a person paragliding

Life adventure hiking t-shirt design

for Mercht-shirt icon
Print ready
Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Outdoor winter sports skiing figure design PNG Design

Premiumcrown icon
Dynamic skiing silhouette design featuring a figure in motion with ski poles
Edit Online BadgeEdit Online

Dynamic skiing magazine cover design t-shirt design template

Vibrant magazine cover design featuring a skilled skier carving through icy slopes

Atv mountain adventure badge PNG Design

Atv mountain adventure badge

Edgy flaming heart skateboard design PNG Design

Premiumcrown icon
Vibrant and playful, this graphic features a heart design enveloped in flames, showcasing two skateboard decks with cute heart details

Racing quad bike silhouette PNG Design

Racing quad bike silhouette

Cartoon dog holding a sword and a shield PNG Design

Premiumcrown icon
A whimsical cartoon dog stands tall, wielding a mighty sword in one paw and clutching a sturdy shield in the other

Cartoon bird riding a skateboard PNG Design

Premiumcrown icon
A cartoon bird wearing sunglasses and a helmet, effortlessly rides a skateboard with ease and confidence

Hiking adventure mountains illustration

Adventure illustration featuring a human silhouette doing hiking

Winter sports customizable design

Editable design featuring tons of different winter sports silhouettes and backgrounds to choose from
of 5
Boost your businesswith the leading graphic platform for merch
SEE PLANS