Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

250 adventure sport designs graphics for t-shirt and print on demand merch

Download adventure sport t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Adventure awaits beyond the horizon PNG Design

A breathtaking sunset over a calm ocean, with hues of orange and pink painting the sky, promising adventures beyond the distant horizon

Mountain bike sport t-shirt design

Dynamic t-shirt design showing a mountain biker with the text: "Adrenaline is my life"

Life adventure hiking t-shirt design

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Paragliding avdenture sport t-shirt design

Awesome t-shirt design featuring a person paragliding and the quote "Speedflying let's shred"

Summer beach umbrella t-shirt design

This playful t-shirt design features a beach umbrella with a striking striped pattern in red and white

Edit Online Badge

Playful dog canoeing adventure illustration t-shirt design template

Charming t-shirt design featuring a playful dog paddling in a canoe

Adventure sports zipline design PNG Design

Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Edit Online Badge

Playful yeti snowboard design t-shirt design template

Bold graphic t-shirt design featuring a playful yeti character holding a snowboard

Mountain biking adventure t-shirt design

Striking t-shirt design with a mountain biker against a backdrop of towering mountains and the phrase "Mountains are calling

Edit Online Badge

Playful helmet design with cherry motif and motivational quotes t-shirt design template

Whimsical helmet design featuring a cherry as the focal point, ideal for sports enthusiasts

Exciting basketball adventure t-shirt design

Playful t-shirt design with a smiling basketball

Edit Online Badge

Dynamic racing quote design t-shirt design template

Bold t-shirt design featuring a high-energy racing car mid-jump

Yeti Santa Claus snowboarding adventure t-shirt design

Eye-catching t-shirt design featuring a Yeti Santa Claus having a blast while snowboarding

Bigfoot skiing adventure t-shirt design

Humorous t-shirt design showing a cartoon Bigfoot skiing downhill, blending cryptozoology with winter sports

Cliff jumping t-shirt design

Dynamic t-shirt design with the text 'Cliff Jumping' over a stark cliff seascape, capturing the thrill of the sport

Slackline sport silhouette PNG Design

Slackline sport silhouette

Edgy flaming heart skateboard design PNG Design

Vibrant and playful, this graphic features a heart design enveloped in flames, showcasing two skateboard decks with cute heart details

Paragliding sunset t-shirt design

Beautiful t-shirt design that features a person paragliding during the sunset

Edit Online Badge

Vintage montana clothing logo design with inspirational quote t-shirt design template

Flat water sports surf creator

Editable design featuring tons of different water sports silhouettes and backgrounds to choose from

E biking adventure t-shirt design

Check out this cool t-shirt design for electronic bikers including a man riding his bike through the forest and the German quote 'Yes, everything's alright'

Girl climbing a rock wall PNG Design

A determined girl scaling a towering rock wall, gripping the handholds tightly as she moves upward with confidence and focus

Silhouette of a person kiteboarding PNG Design

A dark silhouette of a person gliding on the water while kiteboarding, with the colorful kite soaring in the sky above them

Edit Online Badge

Fierce tiger illustration with unleash quote t-shirt design template

Dynamic t-shirt design featuring a roaring tiger and the quote 'Unleash Your Inner Beast' along with the year 1960

Mountain bike vintage t-shirt design

Retro-styled t-shirt design with a mountain bike theme

Line icon of a snowboarder riding a wave PNG Design

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Mountain Climber Adventure Lifestyle T-shirt Design

Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Adventure climbing illustration with sunset and ocean PNG Design

Dynamic sticker design featuring a climber on a rock against a sunset backdrop, embodying outdoor adventure

Edit Online Badge

Vintage mountain escape ski poster design t-shirt design template

Charming vintage poster design featuring a female skier ready for adventure

Stylized shield design with vibrant sunset and claw marks for sports branding PNG Design

Cartoon dog holding a sword and a shield PNG Design

A whimsical cartoon dog stands tall, wielding a mighty sword in one paw and clutching a sturdy shield in the other

Person riding a jet ski on the water PNG Design

A person wearing a life jacket riding a jet ski at high speed on the turquoise water, creating a small splash behind them

Playful skiing dog illustration PNG Design

Charming and whimsical, this illustration features a skier being joyfully pulled by a playful dog

Silhouette of a person parasailing PNG Design

A captivating silhouette of a person gracefully parasailing against a colorful sky, with the parachute billowing in the wind

Outdoor winter sports skiing figure design PNG Design

Dynamic skiing silhouette design featuring a figure in motion with ski poles

Edit Online Badge

Dynamic skiing magazine cover design t-shirt design template

Vibrant magazine cover design featuring a skilled skier carving through icy slopes

Cartoon bird riding a skateboard PNG Design

A cartoon bird wearing sunglasses and a helmet, effortlessly rides a skateboard with ease and confidence

Atv mountain adventure badge PNG Design

Atv mountain adventure badge

Man riding a jet ski at sunset PNG Design

A man gracefully glides across the water on a jet ski, with the vibrant hues of the setting sun painting the sky in the background

Hiking adventure mountains illustration

Adventure illustration featuring a human silhouette doing hiking

Mountain climbing adventure graphic design PNG Design

Dynamic climbing graphic design featuring a silhouetted climber against a scenic backdrop

Man riding a jet ski on the water cut out PNG Design

A man wearing a helmet and life jacket rides a jet ski on the sparkling blue water, leaving a trail of splashes behind him

Adventurous mountain jeep design PNG Design

Dynamic graphic design featuring a jeep on a mountain, complemented by geometric patterns

Dynamic mountain adventure silhouette t-shirt design PNG Design

Dynamic climbing illustration featuring a climber against a mountain backdrop

Winter sports customizable design

Editable design featuring tons of different winter sports silhouettes and backgrounds to choose from

Hot air balloon steampunk PNG Design

A colorful hot air balloon soaring high in the sky, with its vibrant patterns and designs standing out against the clear blue background

Stylish climbing adventure landscape graphic design PNG Design

Dynamic poster design featuring a climber against a vibrant sunset, showcasing an outdoor spirit

Hiking adventure silhouette PNG Design

Hiking adventure silhouette

Retro bicycle adventure design with panniers PNG Design

Playful bike illustration featuring a red touring bicycle and saddle bags, perfect for outdoor enthusiasts

of 5

Boost your businesswith the leading graphic platform for merch