Sign Up
Log in
Vexels Logo
All
Random Search

1578 mountain Vector Designs for T-Shirts and merch

Download & buy editable mountain AI Vector Graphics Designs for T shirts, Phone Cases, Book Covers and other Merch

Sponsored results byShutterstock Logo
Get 15% off with code: VEXELS15
Seeker man illustration

We didn't find any mountain Merch Vectors, but here's all our mountain designs or request design here

Colorful camping tent graphic with nature elements t-shirt design PNG Design

Premiumcrown icon
Playful graphic design featuring a colorful tent with tree silhouettes, perfect for camping enthusiasts

Adventure jeep illustration with mountains PNG Design

Premiumcrown icon
Playful sticker design featuring a yellow jeep amidst mountains, perfect for outdoor enthusiasts

Adventurous camping illustration with knife and nature elements PNG Design

Premiumcrown icon
Playful poster design featuring a knife, log, and trees, symbolizing outdoor adventures

Off-road adventure vehicle illustration with mountains and sunset background t-shirt design PNG Design

Premiumcrown icon
Playful vehicle design featuring a vintage yellow jeep against a mountainous backdrop

Outdoor adventure knife and log design PNG Design

Premiumcrown icon
Playful sticker design featuring a knife embedded in a log, showcasing nature and exploration themes

Adventure-ready jeep graphic design featuring desert landscape elements PNG Design

Premiumcrown icon
Playful sticker design featuring a yellow jeep amidst desert elements, perfect for adventure lovers

Cute pink flamingo with surfboard and summer hat illustration t-shirt design PNG Design

Premiumcrown icon
Whimsical illustration of a flamingo wearing a hat and holding a surfboard, perfect for summer vibes

Vintage jeep off-road sunset design PNG Design

Premiumcrown icon
Dynamic illustration of a yellow jeep in front of mountains, perfect for outdoor enthusiasts

Adventure knife and wood illustration design PNG Design

Premiumcrown icon
Playful t-shirt design featuring a knife embedded in a log, symbolizing adventure

Playful vintage maple syrup bottle design PNG Design

Premiumcrown icon
Charming illustration of a maple syrup bottle with a distinct lid and tree logo

Dog Trekking T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Adventure knife and log badge design PNG Design

Premiumcrown icon
Stylized badge design featuring a knife, log, and plant elements, symbolizing outdoor exploration

Snowboard jump t-shirt design

for Mercht-shirt icon
Print ready
Awesome t-shirt design featuring a snowboarder jumping

Artistic sun and flower graphic design PNG Design

Premiumcrown icon
Playful poster design featuring sun and flower motifs with a creative layered structure

Japanese flamingo t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design featuring a sunset a flamingo flowers and japanese letters

Smoky Mountains T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design about Smoky Mountains featuring a road pines and a rocky landscape in a sunset and the words SMOKY MOUNTAINS

Vintage ocean and sun waves graphic design t-shirt design PNG Design

Premiumcrown icon
Playful poster design featuring stylized sun and wavy ocean patterns, creating a serene artistic vibe

Alps mountains stroke PNG Design

Alps mountains stroke

Viking Compass T-shirt Design

for Mercht-shirt icon
Print ready
Viking Compass T-shirt Design featuring a detailed illustration of a viking compass with viking symbols on it an some mountains and moon on its back

Geometric crown and moon illustration PNG Design

Premiumcrown icon
Vibrant digital illustration featuring a geometric crown with layered patterns and a crescent moon above

Carabiner climbing t-shirt design

for Mercht-shirt icon
Print ready
Great t-shirt design that features a carabiner with a man climbing design inside

Colorful vintage bottle design with tropical leaves art print PNG Design

Premiumcrown icon
Playful graphic design featuring a sauce bottle with a unique cap and logo details

Simple cut stroke log PNG Design

Simple cut stroke log

Semi flat blue snowmobile PNG Design

Semi flat blue snowmobile

Minimalist line art of a mother and child in nature PNG Design

Premiumcrown icon
Elegant line art design showcasing a mother holding hands with her child, depicting a serene outdoor scene

Vintage yellow jeep illustration for adventure lovers PNG Design

Premiumcrown icon
Playful sticker design featuring a yellow jeep, highlighting its rugged features and adventurous spirit

Vintage inspired nature-themed bottle illustration PNG Design

Premiumcrown icon
Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Hate People T-shirt Design

for Mercht-shirt icon
Print ready
Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

Sunset landscape t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design featuring an illustration of a landscape with the sun setting between the mountains

Hiking Outdoors T-Shirt Design

for Mercht-shirt icon
Print ready
Hiking Outdoors T-Shirt Design featuring three hikers going up a mountain with a nice forest scene behind them

Utah Climbing T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Simple hand drawn rocks stroke PNG Design

Simple hand drawn rocks stroke

Climbing mountains cool t-shirt design

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

Adventure-ready jeep sticker design PNG Design

Premiumcrown icon
Playful sticker design featuring a rugged jeep among trees, perfect for outdoor enthusiasts

Playful vintage bottle design with nature elements PNG Design

Premiumcrown icon
Charming bottle illustration featuring a unique design, accented with natural motifs

Eco Nature Lanscape

2 great Eco Natural logo labels

Vintage off-road vehicle graphic design PNG Design

Premiumcrown icon
Dynamic sticker design featuring a rugged jeep with bold tires and scenic elements

Hiking german quote t-shirt design

for Mercht-shirt icon
German Content
Print ready
Cool t-shirt design featuring the quote in German "Mehr wandern weniger sorgen" (More hiking less worries)

Colorful nature-inspired bottle illustration design PNG Design

Premiumcrown icon
Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Life adventure hiking t-shirt design

for Mercht-shirt icon
Print ready
Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Vintage style potion bottle illustration PNG Design

Premiumcrown icon
Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Vintage style bottle badge design PNG Design

Premiumcrown icon
Playful badge design featuring a vintage-style bottle with artistic details and iconography

Playful nature-themed water bottle design PNG Design

Premiumcrown icon
Vibrant illustration of a water bottle surrounded by trees and mountains, featuring a distinctive logo

Playful vintage style bottle design PNG Design

Premiumcrown icon
Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Flat red snowmobile PNG Design

Flat red snowmobile

Vintage camping water bottle illustration with nature elements PNG Design

Premiumcrown icon
Playful sticker design featuring a yellow water bottle with a tree logo and natural accents

Stylized vintage bottle illustration PNG Design

Premiumcrown icon
Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Biker falling silhouette design

Cool illustration design that features a biker falling off his bike in silhouette style

Bicycle helmet cut out PNG Design

Bicycle helmet cut out
of 32
Boost your businesswith the leading graphic platform for merch
SEE PLANS