Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

425 hiking PNG and SVG design graphic

Download hiking PNG & SVG Designs with transparent background for T-Shirts, book covers, phone cases and other merch.

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Seeker man illustration

We didn't find any hiking PNGs For Merch, but here's all our hiking designs or request design here

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Adventure themed zipline design PNG Design

Dynamic poster design featuring a silhouetted zipliner amidst trees and mountains

One with the Mountains T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Mountain Love T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Silhouette of backpacker with sunset and mountain scenery t-shirt design PNG Design

Dynamic illustration featuring a hiker against stylized mountains and sun

Winter mountain landscape illustration

Flat illustration featuring a field with some trees and mountains on the horizon

Let's Get Real High T-shirt Design

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Boy on Rock Landscape T-shirt Design

T-shirt design featuring a boy on top of a rock holding a balloon

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Stroke mountain t-shirt design

Cool mountain theme t-shirt design featuring stroke lines looking like mountain over grunge stripes backdrop

Vintage mountain logo PNG Design

Unique bottle design with mountain motif PNG Design

Dynamic mountain adventure silhouette t-shirt design PNG Design

Dynamic climbing illustration featuring a climber against a mountain backdrop

Set of isolated mountain illustrations

Set of mountain illustrations in different tones and shapes

Flat mountain woods landscape

Flat landscape illustration featuring lots of mountains and woods

Mountains Await T-shirt Design

Cool Black and white T-shirt design with a mountain over the clouds illustration

Forest landscape with tall trees

Illustration featuring a pine tree forest viewed from the ground

Identification Of Practical Common Vector

Identification of practical common vector image in

Come Away With Me T-shirt Design

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Forever a mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Olympic national park quote t-shirt design

Awesome t-shirt design featuring pine trees over a mountain and the quote "Winter hiking warms my soul"

Adventure silhouette graphic design with mountains and sun PNG Design

Vibrant poster design featuring a hikers silhouette against a scenic mountain backdrop

Flat mountain landscape design

Flat winter landscape illustration featuring lots of mountains snow and woods

Isolated mountain illustration set

Set of mountain illustrations in different shapes and tones

Sports Silhouette Collecton

Huge collection of various sports silhouettes

Vintage camping water bottle illustration with nature elements PNG Design

Flat nature landscape design

Flat landscape illustration featuring lots of hills fields and woods

Green forest landscape with deer

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Camping icons and elements

Camping is one big way of enjoy life outdoors

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Flat forest landscape illustration

Flat landscape illustration featuring a forest mountain and river

Calm field landscape illustration

Flat illustration featuring a field with some hills on the horizon

Mountain lake flat landscape

Beautiful mountains landscape with turquoise lake pine tree forest hills cloudy sky snowed peaks and aero-static globe

Flat camping illustration

Flat illustration featuring a camping on a forest with a tent campfire and other details

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Camping landscape illustration with campfire

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Forest and mountains landscape with deer

Flat landscape illustration featuring lots of trees mountains and a deer

Adventure Awaits Outdoor Experience T-shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Mountain with snow landscape illustration

Flat winter landscape illustration featuring lots of mountains snow and some woods

Mountain nature landscape

Illustrated nature landscape featuring mountains trees and clouds

Camping survival kit

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

Mountains Calling T-shirt Design

Cool t-shirt design showing a badge with mountains illustration and "Mountains Are Calling" caption

Sunrise on the mountains illustration

Low poly illustration featuring moutains and the sun rays coming through them

Forest sunset illustration landscape

Flat landscape illustration featuring a forest with light coming through the tree branches

Mountain landscape illustration design

Flat illustration featuring moutains and their reflection

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Forest landscape illustration with snow

Flat illustration featuring a forest with falling snow and bokeh

Everything For You T-shirt Design

Nice t-shirt design featuring an illustration of couples mountain climbing with "I do everything for you" caption

Boost your businesswith the leading graphic platform for merch