Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

379 hiking PNG and SVG design graphic

Download hiking PNG & SVG Designs with transparent background for T-Shirts, book covers, phone cases and other merch.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Seeker man illustration

We didn't find any hiking PNGs For Merch, but here's all our hiking designs or request design here

Lightweight retro lantern illustration design PNG Design

Playful poster design featuring a vintage camping lantern with intricate detailing

Playful vintage maple syrup bottle design PNG Design

Adventure themed zipline design PNG Design

Dynamic poster design featuring a silhouetted zipliner amidst trees and mountains

Stylized vintage lantern graphic design for outdoor enthusiasts PNG Design

Charming illustration of a classic lantern with a distinctive silhouette and a playful camping vibe

Mountain Couple Quote T-shirt Design

T-shirt design featuring a couple silhouette walking towards a mountain and a quote saying TAKE ME TO THE MOUNTAIN

Colorful camping scene with mountains illustration design PNG Design

Playful camping illustration featuring a vibrant tent and mountain outline

Camp Hair Don't Care Funny Quote Camping T-shirt Design

Camp Hair Don't Care Funny Quote Camping T-shirt Design depicting a bonfire and a quote that says Camp Hair Don't Care perfect for camping hiking and outdoor activities

Hiker and Climber People Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Mountain nature landscape

Illustrated nature landscape featuring mountains trees and clouds

Colorful vintage bottle design with tropical leaves art print PNG Design

Boy on Rock Landscape T-shirt Design

T-shirt design featuring a boy on top of a rock holding a balloon

Funny Snow Goggles T-shirt Design

T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Camping vintage t-shirt design

Great t-shirt design that features a tent in the woods with the caption "1981" in vintage style

Mountain Landscape Badge Set

Badge set featuring two badges with mountain landscape in them in stroke style

Unique bottle design with mountain motif PNG Design

Mountains stroke icon PNG Design

Snow mountain climbing PNG Design

Snow mountain climbing

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Silhouette of backpacker with sunset and mountain scenery t-shirt design PNG Design

Dynamic illustration featuring a hiker against stylized mountains and sun

Camping flat elements set

Awesome flat style set featuring camping elements such as a tent a bonfire and more

Mountains German quote t-shirt design

Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Dynamic mountain adventure silhouette t-shirt design PNG Design

Dynamic climbing illustration featuring a climber against a mountain backdrop

Mountain Heartbeat Line Design

Design featuring a heartbeat line with a mountain in it

Weekend Camping T-shirt Design

T-shirt design featuring a girl looking through binoculars and the quote WEEKEND

Stroke camping compass PNG Design

Stroke camping compass

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

Seven Summits Mountain T-shirt Design

T-shirt design featuring the seven highest mountain summits

Adventure silhouette graphic design with mountains and sun PNG Design

Vibrant poster design featuring a hikers silhouette against a scenic mountain backdrop

Landscape Badge Design Pack

Badge design pack featuring two landscape design badges including natural landscapes

Forever a mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Dog Trekking T-shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Stroke compass instrument PNG Design

Stroke compass instrument

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Nature Landscape Outdoor Badge Pack

Badge pack featuring two natural landscapes namely tropical island and mountain cabin

Great Wilderness Quote T-shirt Design

T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Everything For You T-shirt Design

Nice t-shirt design featuring an illustration of couples mountain climbing with "I do everything for you" caption

Playful nature-themed water bottle design PNG Design

Nature Landscape Badge Pack

Badge pack featuring two nature landscape designs namely a tropical island seen from the sea and a hut between mountains

Forever mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Vintage mountain water bottle design PNG Design

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Mountain climber silhouette 3 PNG Design

Mountain climber silhouette 3

Nature-inspired water bottle design with mountain and night sky elements PNG Design

Charming sticker design featuring a yellow water bottle with a nature motif and a moonlit backdrop

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Vintage camping water bottle illustration with nature elements PNG Design

Landscape cut out PNG Design

Landscape cut out

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Climbing mountain silhouette 1 PNG Design

Climbing mountain silhouette 1

of 8

Boost your businesswith the leading graphic platform for merch