Sign Up
Log in
Vexels Logo

379 hiking PNG and SVG design graphic

Download hiking PNG & SVG Designs with transparent background for T-Shirts, book covers, phone cases and other merch.

Sponsored results byShutterstock Logo
Get 15% off with code: VEXELS15
Seeker man illustration

We didn't find any hiking PNGs For Merch, but here's all our hiking designs or request design here

Lightweight retro lantern illustration design PNG Design

Premiumcrown icon
Playful poster design featuring a vintage camping lantern with intricate detailing

Playful vintage maple syrup bottle design PNG Design

Premiumcrown icon
Charming illustration of a maple syrup bottle with a distinct lid and tree logo

Adventure themed zipline design PNG Design

Premiumcrown icon
Dynamic poster design featuring a silhouetted zipliner amidst trees and mountains

Stylized vintage lantern graphic design for outdoor enthusiasts PNG Design

Premiumcrown icon
Charming illustration of a classic lantern with a distinctive silhouette and a playful camping vibe

Mountain Couple Quote T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a couple silhouette walking towards a mountain and a quote saying TAKE ME TO THE MOUNTAIN

Colorful camping scene with mountains illustration design PNG Design

Premiumcrown icon
Playful camping illustration featuring a vibrant tent and mountain outline

Camp Hair Don't Care Funny Quote Camping T-shirt Design

for Mercht-shirt icon
Camp Hair Don't Care Funny Quote Camping T-shirt Design depicting a bonfire and a quote that says Camp Hair Don't Care perfect for camping hiking and outdoor activities

Hiker and Climber People Silhouette Set

Premiumcrown icon
People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Mountain nature landscape

Illustrated nature landscape featuring mountains trees and clouds

Colorful vintage bottle design with tropical leaves art print PNG Design

Premiumcrown icon
Playful graphic design featuring a sauce bottle with a unique cap and logo details

Boy on Rock Landscape T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a boy on top of a rock holding a balloon

Funny Snow Goggles T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Camping vintage t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Great t-shirt design that features a tent in the woods with the caption "1981" in vintage style

Mountain Landscape Badge Set

Premiumcrown icon
Badge set featuring two badges with mountain landscape in them in stroke style

Unique bottle design with mountain motif PNG Design

Premiumcrown icon
Playful sticker design featuring a bottle with a mountain logo and a plant accent

Mountains stroke icon PNG Design

Mountains stroke icon

Snow mountain climbing PNG Design

Premiumcrown icon
Snow mountain climbing

Vintage inspired nature-themed bottle illustration PNG Design

Premiumcrown icon
Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Silhouette of backpacker with sunset and mountain scenery t-shirt design PNG Design

Premiumcrown icon
Dynamic illustration featuring a hiker against stylized mountains and sun

Camping flat elements set

Premiumcrown icon
Awesome flat style set featuring camping elements such as a tent a bonfire and more

Mountains German quote t-shirt design

for Mercht-shirt icon
German Content
Print ready
Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Dynamic mountain adventure silhouette t-shirt design PNG Design

Premiumcrown icon
Dynamic climbing illustration featuring a climber against a mountain backdrop

Mountain Heartbeat Line Design

Premiumcrown icon
Design featuring a heartbeat line with a mountain in it

Weekend Camping T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a girl looking through binoculars and the quote WEEKEND

Stroke camping compass PNG Design

Stroke camping compass

Playful vintage bottle design with nature elements PNG Design

Premiumcrown icon
Charming bottle illustration featuring a unique design, accented with natural motifs

Seven Summits Mountain T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring the seven highest mountain summits

Adventure silhouette graphic design with mountains and sun PNG Design

Premiumcrown icon
Vibrant poster design featuring a hikers silhouette against a scenic mountain backdrop

Landscape Badge Design Pack

Badge design pack featuring two landscape design badges including natural landscapes

Forever a mountaineer t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Dog Trekking T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Stroke compass instrument PNG Design

Premiumcrown icon
Stroke compass instrument

Colorful nature-inspired bottle illustration design PNG Design

Premiumcrown icon
Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Nature Landscape Outdoor Badge Pack

Premiumcrown icon
Badge pack featuring two natural landscapes namely tropical island and mountain cabin

Great Wilderness Quote T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Everything For You T-shirt Design

for Mercht-shirt icon
Print ready
Nice t-shirt design featuring an illustration of couples mountain climbing with "I do everything for you" caption

Playful nature-themed water bottle design PNG Design

Premiumcrown icon
Vibrant illustration of a water bottle surrounded by trees and mountains, featuring a distinctive logo

Nature Landscape Badge Pack

Premiumcrown icon
Badge pack featuring two nature landscape designs namely a tropical island seen from the sea and a hut between mountains

Forever mountaineer t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Vintage mountain water bottle design PNG Design

Premiumcrown icon
Playful illustration of a mountain-themed water bottle with a bold tree logo

Vintage style potion bottle illustration PNG Design

Premiumcrown icon
Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Mountain climber silhouette 3 PNG Design

Premiumcrown icon
Mountain climber silhouette 3

Nature-inspired water bottle design with mountain and night sky elements PNG Design

Premiumcrown icon
Charming sticker design featuring a yellow water bottle with a nature motif and a moonlit backdrop

Vintage style bottle badge design PNG Design

Premiumcrown icon
Playful badge design featuring a vintage-style bottle with artistic details and iconography

Playful vintage style bottle design PNG Design

Premiumcrown icon
Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Vintage camping water bottle illustration with nature elements PNG Design

Premiumcrown icon
Playful sticker design featuring a yellow water bottle with a tree logo and natural accents

Landscape cut out PNG Design

Landscape cut out

Stylized vintage bottle illustration PNG Design

Premiumcrown icon
Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Climbing mountain silhouette 1 PNG Design

Climbing mountain silhouette 1
of 8
Boost your businesswith the leading graphic platform for merch
SEE PLANS