Sign Up
Log in
Vexels Logo
All
Random Search

4968 e sports designs graphics for t-shirt and print on demand merch

Download e sports t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results byShutterstock Logo
Get 15% off with code: VEXELS15

Basket mom sports design PNG Design

Premiumcrown icon
Bold t-shirt design featuring the phrase Basket Mom and a basketball icon

Male & Female Volleyball Player Pack Silhouette

Huge pack of volleyball sports silhouette contains mostly female with few male 50 or more players in numerous playing positions

Stylized basketball emblem design with star background and banner overlay PNG Design

Premiumcrown icon
Bold emblem design featuring a basketball at the center, surrounded by a star shape and a blank banner for personalization

Dynamic baseball logo design with glove and bats PNG Design

Premiumcrown icon
Bold baseball logo design featuring a glove, ball, and bats, ideal for sports branding

Bold baseball helmet and ball emblem design PNG Design

Premiumcrown icon
Stylish logo design featuring a baseball helmet and baseball, perfect for sports-themed graphics

Sporty baseball glove and bat emblem design PNG Design

Premiumcrown icon
Bold sports logo design featuring a glove, ball, and crossed bats with a customizable banner

Playful baseball logo design with cap and badge PNG Design

Premiumcrown icon
Dynamic graphic design featuring a baseball and a cap within a badge and a blank banner

Vintage basketball trophy design with decorative laurel accents PNG Design

Premiumcrown icon
Dynamic emblem design featuring a basketball, laurel leaves, and a customizable banner below

Basketball wreath design with customizable banner PNG Design

Premiumcrown icon
Classic basketball design featuring a ball and laurel leaves, ideal for trophies or awards

Basketball achievement medal design with decorative elements PNG Design

Premiumcrown icon
Dynamic graphic design featuring a basketball and laurel wreath for awards

Soccer trophy award design with laurel and blank banner PNG Design

Premiumcrown icon
Bold vector design featuring a soccer ball, laurel leaves, and a customizable banner for text

Dynamic baseball emblem with crossed bats and customizable text PNG Design

Premiumcrown icon
Bold badge design featuring a baseball, crossed bats, and a blank ribbon for personalization

Vintage baseball emblem design with bat and balls, badge style PNG Design

Premiumcrown icon
Bold emblem design featuring a bat, baseballs, and a customizable banner

Stylish heart and basketball logo design PNG Design

Premiumcrown icon
Playful logo design featuring a heart-shaped basketball with a blank banner for custom text

Bold flaming basketball emblem design with star background PNG Design

Premiumcrown icon
Vibrant logo design featuring a basketball with flames and a customizable banner below

Stylish soccer crest design with a crown and soccer ball PNG Design

Premiumcrown icon
Eye-catching badge design featuring a crown, soccer ball, and ornate banner

Dynamic morocco sports design with handball player PNG Design

Premiumcrown icon
Striking emblem design featuring a handball player and the word 'Morocco' above, symbolizing athletic spirit

Dynamic icelandic sports emblem design PNG Design

Premiumcrown icon
Energetic emblem design featuring a silhouette of an athlete and Icelandic flag elements

Sports Silhouette Mega Pack

Huge set of sports silhouette contains over 100 in action sporting peoples in various poses

Cheerful football design with bow and pom-pom PNG Design

Premiumcrown icon
Playful illustration featuring a football adorned with a bow and a pom-pom

Ski snow & style t-shirt design

for Mercht-shirt icon
Editable text
Print ready
A cool t-shirt design featuring a skier and the words 'snow and style to descend'

Lacrosse stick and ball design PNG Design

Premiumcrown icon
This design features a blue lacrosse stick and ball, with a white background

Playful basketball design with a ribbon and pom-pom PNG Design

Premiumcrown icon
Charming illustration featuring a basketball tied with a ribbon and a pom-pom, perfect for sports enthusiasts

Proud papa sports lover design with football illustration PNG Design

Playful t-shirt design featuring the text 'Sports Lover' and 'Proud Papa' with a football graphic

Sporty football and flannels graphic design PNG Design

Premiumcrown icon
Playful t-shirt design featuring bold text that reads 'Football & Flannels' for cozy fall vibes

Sports Silhouette Collecton

Huge collection of various sports silhouettes

Soccer balls and countries set

Premiumcrown icon
Amazing set design that features soccer balls dabbing and country flags like Brazil, USA, Germany and more!

Bicycle Bmx and Motorcycle

Bicycle BMX and Motorcycle silhouettes jumping downhill

Handball Bowling and Golf Banners

Set of 3 banners featuring balls for their respective games and sports

Couple sports t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Cool t-shirt design featuring a mimic of a sports jersey with the number 01 and the title "His queen"

Sports Vector 02

Hello there! This is the second set of the sports vector

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

6 Extreme sports badges

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

6 sports badges emblems

This set of sport badges emblems or insignias feature sport balls with the name of the sport

4 Extreme sports and rock badges

4 Badges in black and white with images of extreme sports like motocross surf and skateboard and also an image of a rock n? roll drummer

Sports Player Silhouette Collection

Collection of 9 different sports' players and athletes

Triathlon Sports T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring three sports silhouettes for each discipline of Triathlon and the word TRIATHLON in red

Baseball player and quotes t-shirt design

for Mercht-shirt icon
Print ready
Awesome t-shirt design featuring a baseball player with quotes such as pitcher, game, bat, sports and more! Use this print ready design for tshirts, posters, mug, hoodies and other merch products

Bicycle Label And Logo Design Set

Set of creative bicycle themed logos and label designs in black and white

Bogey is the new par golfing t-shirt design

for Mercht-shirt icon
Print ready
Check out this great golfing t-shirt design including a golfer's silhouette and the quote 'Bogey is the new par'

Game Sports Icons

Sports symbols and icons

Never Give Up Sports Quote Design

Premiumcrown icon
Sports quote design saying NEVER GIVE UP

99 Problems Sports T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a quote saying I GOT 99 PROBLEMS BUT SKILLZ AIN'T ONE

Male & Female Tennis Player Silhouette Pack

Set of 24 numerous tennis players in flat black silhouette style illustration

Sports Cat T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a sporty cat wearing a headband and sunglasses

American football tennis and Baseball Banners

Sports are big parts of our lives and specially entertainment

Stylized shield design with vibrant sunset and claw marks for sports branding PNG Design

Premiumcrown icon
Striking logo design featuring a shield shape, claw marks, and a central sun motif

Baseball emblem design with crossed bats and ball PNG Design

Premiumcrown icon
Dynamic emblem design featuring crossed baseball bats and a ball, perfect for sports teams or enthusiasts

Dynamic baseball graphic design with bat and flames PNG Design

Premiumcrown icon
Vibrant graphic design featuring a baseball bat with flames and balls, perfect for sports enthusiasts

Vintage baseball emblem design with cap and banner PNG Design

Premiumcrown icon
Dynamic badge design featuring a baseball and cap with a customizable banner for personalization
of 100
Boost your businesswith the leading graphic platform for merch
SEE PLANS