Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

1578 mountain Icons in SVG, PNG, AI

Download mountain Icons in SVG, PNG, AI for commercial use.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Seeker man illustration

We didn't find any mountain Icons, but here's all our mountain designs or request design here

Colorful camping tent graphic with nature elements t-shirt design PNG Design

Playful graphic design featuring a colorful tent with tree silhouettes, perfect for camping enthusiasts

Adventure jeep illustration with mountains PNG Design

Playful sticker design featuring a yellow jeep amidst mountains, perfect for outdoor enthusiasts

Adventurous camping illustration with knife and nature elements PNG Design

Playful poster design featuring a knife, log, and trees, symbolizing outdoor adventures

Off-road adventure vehicle illustration with mountains and sunset background t-shirt design PNG Design

Playful vehicle design featuring a vintage yellow jeep against a mountainous backdrop

Outdoor adventure knife and log design PNG Design

Playful sticker design featuring a knife embedded in a log, showcasing nature and exploration themes

Adventure-ready jeep graphic design featuring desert landscape elements PNG Design

Playful sticker design featuring a yellow jeep amidst desert elements, perfect for adventure lovers

Cute pink flamingo with surfboard and summer hat illustration t-shirt design PNG Design

Whimsical illustration of a flamingo wearing a hat and holding a surfboard, perfect for summer vibes

Vintage jeep off-road sunset design PNG Design

Dynamic illustration of a yellow jeep in front of mountains, perfect for outdoor enthusiasts

Playful vintage maple syrup bottle design PNG Design

Adventure knife and wood illustration design PNG Design

Playful t-shirt design featuring a knife embedded in a log, symbolizing adventure

Flat red snowmobile PNG Design

Flat red snowmobile

Adventure knife and log badge design PNG Design

Stylized badge design featuring a knife, log, and plant elements, symbolizing outdoor exploration

Hiking german quote t-shirt design

Cool t-shirt design featuring the quote in German "Mehr wandern weniger sorgen" (More hiking less worries)

Simple hand drawn rocks stroke PNG Design

Simple hand drawn rocks stroke

Artistic sun and flower graphic design PNG Design

Playful poster design featuring sun and flower motifs with a creative layered structure

Bicycle helmet cut out PNG Design

Bicycle helmet cut out

Life adventure hiking t-shirt design

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Vintage ocean and sun waves graphic design t-shirt design PNG Design

Playful poster design featuring stylized sun and wavy ocean patterns, creating a serene artistic vibe

Japanese flamingo t-shirt design

Beautiful t-shirt design featuring a sunset a flamingo flowers and japanese letters

Smoky Mountains T-shirt Design

T-shirt design about Smoky Mountains featuring a road pines and a rocky landscape in a sunset and the words SMOKY MOUNTAINS

Geometric crown and moon illustration PNG Design

Vibrant digital illustration featuring a geometric crown with layered patterns and a crescent moon above

Sunset landscape t-shirt design

Beautiful t-shirt design featuring an illustration of a landscape with the sun setting between the mountains

Viking Compass T-shirt Design

Viking Compass T-shirt Design featuring a detailed illustration of a viking compass with viking symbols on it an some mountains and moon on its back

Colorful vintage bottle design with tropical leaves art print PNG Design

Carabiner climbing t-shirt design

Great t-shirt design that features a carabiner with a man climbing design inside

Minimalist line art of a mother and child in nature PNG Design

Elegant line art design showcasing a mother holding hands with her child, depicting a serene outdoor scene

Vintage yellow jeep illustration for adventure lovers PNG Design

Playful sticker design featuring a yellow jeep, highlighting its rugged features and adventurous spirit

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Hate People T-shirt Design

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

Semi flat blue snowmobile PNG Design

Semi flat blue snowmobile

Dog Trekking T-shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Hiking Outdoors T-Shirt Design

Hiking Outdoors T-Shirt Design featuring three hikers going up a mountain with a nice forest scene behind them

Utah Climbing T-shirt Design

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Adventure-ready jeep sticker design PNG Design

Playful sticker design featuring a rugged jeep among trees, perfect for outdoor enthusiasts

Eco Nature Lanscape

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

Climbing mountains cool t-shirt design

T-shirt design featuring the silhouette of someone climbing a mountain

Vintage off-road vehicle graphic design PNG Design

Dynamic sticker design featuring a rugged jeep with bold tires and scenic elements

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Playful nature-themed water bottle design PNG Design

Alps mountains stroke PNG Design

Alps mountains stroke

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Simple cut stroke log PNG Design

Simple cut stroke log

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Vintage camping water bottle illustration with nature elements PNG Design

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Biker falling silhouette design

Cool illustration design that features a biker falling off his bike in silhouette style

Snowboard jump t-shirt design

Awesome t-shirt design featuring a snowboarder jumping

of 32

Boost your businesswith the leading graphic platform for merch