Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

289 climbing Vectors & Graphics to Download

Download climbing editable vector graphics for every design project. In AI, SVG, PNG, JPG and PSD.

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Seeker man illustration

We didn't find any climbing Vectors, but here's all our climbing designs or request design here

Blue walking gnome PNG Design

Blue walking gnome

Rock Climber Quote T-shirt Design

T-shirt design for rock climbers with a quote saying DON'T FOLLOW ME - I DO STUPID THINGS

Mountains German quote t-shirt design

Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

The walking gnome PNG Design

The walking gnome

Can't you see all this green is luck for me turtle PNG Design

A turtle sitting in a field of lush green grass, symbolizing luck for the turtle

Munros hiking t-shirt design

Beautiful t-shirt design depicting a Munro, a mountain in Scotland with a height over 3,000 feet

Bouldering man sketch t-shirt design

Great t-shirt design featuring a man practicing buldering in sketch style

Dynamic mountain adventure silhouette t-shirt design PNG Design

Dynamic climbing illustration featuring a climber against a mountain backdrop

Mountain camping badge PNG Design

Mountain camping badge

Female climber blue PNG Design

Female climber blue

Adventure themed zipline design PNG Design

Dynamic poster design featuring a silhouetted zipliner amidst trees and mountains

Playful cat christmas tree design PNG Design

Whimsical illustration featuring a cat climbing a Christmas tree with gifts below

Colorful hiking boot illustration with camo background t-shirt design PNG Design

Playful graphic design featuring a detailed hiking boot, emphasizing adventure and outdoor spirit

Mountain Silhouette Icon Set

Aim high mountain t-shirt design

T-shirt design featuring the silhouette of someone climbing a mountain

Retro Camping Logos and Hiking Badges Emblems

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Mountain silhouette t-shirt design

T-shirt design featuring the silhouette of someone climbing a mountain

Female climber stroke PNG Design

Female climber stroke

Forever a mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Mountain label badge template

Label or badge design featuring a mountain silhouette in tones of green and blue

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Climber camping badge PNG Design

Climber camping badge

Mountain landscape with hiking silhouette t-shirt design PNG Design

Dynamic poster design featuring a hiker silhouette against mountains and sun

Seven Summits Mountain T-shirt Design

T-shirt design featuring the seven highest mountain summits

Colorful mountain boot illustration with sun and rock elements t-shirt design PNG Design

Playful sticker design featuring a vibrant hiking boot with mountains and sun elements

Mountain climber nature t-shirt design

Awesome t-shirt design featuring a person climbing a mountain with trees and a lake in the background

Great Wilderness Quote T-shirt Design

T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Forever mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

6 mountain badge logo templates

Mountain camping label PNG Design

Mountain camping label

Bouldering evolution t-shirt design

Awesome design featuring different silhouettes in a mountain landscape, depicting evolution

Stylish hiking boot logo design PNG Design

Magnolia snake nature t-shirt design

Look at this awesome t-shirt design of a green snake climbing up a magnolia! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Mountains stroke icon PNG Design

Mountain Climber Adventure Lifestyle T-shirt Design

Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Bald Guy Climbing Stairs Sequence 9 PNG Design

Bald man climbing stairs with both feet down

Kids Playing Character Pack

Character pack featuring 4 kids playing and doing different activities

Colorful mountain boot graphic design PNG Design

Playful sticker design featuring a vibrant hiking boot with detailed laces and rugged soles

Man Climbing Stairs Sequence 3 PNG Design

Silhouette of man climbing stairs with two feet down

Guy Climbing Stairs Sequence 3 PNG Design

Silhouette of man climbing stairs with two feet down in brown color

Man climbing stairs sequence 5 PNG Design

Man climbing stairs sequence 5

Man climbing stairs illustration PNG Design

Man climbing stairs illustration

Man Climbing Stairs Silhouette Sequence PNG Design

Bald man climbing stairs with one feet steady and the other one climbing

Man climbing stairs sequence 8 PNG Design

Man climbing stairs sequence 8

Guy Climbing Stairs Silhouette Sequence PNG Design

Bald guy climbing stairs with one feet steady and the other one climbing

Man climbing stairs sequence 7 PNG Design

Man climbing stairs sequence 7

Humorous ladder design with friday the 13th theme PNG Design

Playful digital art of a ladder featuring a note saying 'Fri 13th' with a smiley face

Man climbing stairs sequence 2 PNG Design

Man climbing stairs sequence 2

Retro hiking and camping label badges

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

of 6

Boost your businesswith the leading graphic platform for merch