Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

1634 adventure Vectors & Graphics to Download

Download adventure editable vector graphics for every design project. In AI, SVG, PNG, JPG and PSD.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Seeker man illustration

We didn't find any adventure Vectors, but here's all our adventure designs or request design here

Abstract nature scene with trees and moon t-shirt design PNG Design

Charming digital illustration portraying a serene mountain landscape

Whimsical beach style flamingo design PNG Design

Playful t-shirt design featuring a distinctive flamingo in flight, surrounded by stylized stars

Playful birthday quote design PNG Design

Dynamic and lively, this design features the phrase 'Another lap around the sun' prominently displayed in bold, expressive typography

Dynamic motorcycle helmet design with motivational quote PNG Design

Bold and striking, this design features a motorcycle helmet with wings, symbolizing freedom and speed

Bear illustration with customizable text t-shirt design template

Edit Online Badge

Striking t-shirt design featuring a detailed bear illustration in a powerful pose

Vintage fun rides logo design PNG Design

Charming happy campers quote design PNG Design

Playful t-shirt design featuring the phrase 'Happy Campers' in whimsical script

Futuristic astronaut design with universe tour theme t-shirt design template

Edit Online Badge

Vibrant and captivating poster design featuring a detailed illustration of a female astronaut in a space helmet

Playful flamingo beach style design PNG Design

Vibrant and playful, this graphic design features a whimsical pink flamingo soaring through a starry sky

Futuristic canine troop design featuring a space dog t-shirt design template

Edit Online Badge

Bold digital illustration showcasing a stylized dog character wearing advanced headphones and a sleek helmet

Retro video game art featuring space monsters t-shirt design template

Edit Online Badge

Playful t-shirt design showcasing vibrant illustrations of space monsters and a heroic character

Elegant free bird quote design t-shirt design template

Edit Online Badge

Striking and whimsical, this poster design features two birds in flight, symbolizing freedom

Intricate moose skull design with nature theme t-shirt design template

Edit Online Badge

Striking and detailed, this t-shirt design features an intricate illustration of a moose skull adorned with foliage and antlers

Playful horse cycling design with motivational quotes t-shirt design template

Edit Online Badge

Dynamic and playful, this t-shirt design features a cartoon horse character energetically riding a bicycle

Fantasy princess and unicorn coloring page PNG Design

Playful coloring page featuring a whimsical princess riding a unicorn

Tulum beach paradise travel poster t-shirt design template

Edit Online Badge

Vibrant travel poster design showcasing Tulum's enchanting seaside landscape

Rally car design with bold typography t-shirt design template

Edit Online Badge

Dynamic rally car design featuring a classic racing vehicle in motion

Space voyage astronaut design t-shirt design template

Edit Online Badge

Bold graphic design featuring an astronaut in a space suit, surrounded by a globe motif

Astronaut surfing graphic design t-shirt design template

Edit Online Badge

Playful and adventurous, this poster design features an astronaut skillfully surfing a vibrant wave

Charming bonfire quote design t-shirt design template

Edit Online Badge

Playful t-shirt design featuring the quote 'Life is better by a bonfire'

Powerful warrior with electric guitar design PNG Design

Dynamic and bold, this illustration features a muscular warrior raising an electric guitar that resembles a weapon

Playful cartoon snowboarder design PNG Design

Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Artistic illustration of submerged figures in water PNG Design

Contemporary and evocative, this poster design features a unique depiction of two legs sticking out of the water, surrounded by submerged heads

Whimsical heart balloon design PNG Design

Playful hot air balloon design featuring vibrant pink colors and detailed heart motifs

Playful scooter design with flaming wheels PNG Design

Vibrant and playful, this digital illustration features a scooter in bold pink, complete with fiery flames shooting from its wheels

Iconic bigfoot silhouette design PNG Design

Bold graphic design featuring a walking bigfoot silhouette, perfect for T-shirts or wall art

Fearless in the water t-shirt design PNG Design

A blue and white design that says 'Fearless in the Water' in a bold font

Pile of three books doodle PNG Design

Pile of three books doodle

Hiking man silhouette PNG Design

Hiking man silhouette

Vintage airship graphic design PNG Design

Sleek and minimalist, this design features a vintage airship rendered in a bold dark blue against a light gray background

Green forest landscape with deer

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Cruise cut out PNG Design

Cruise cut out

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Camping silhouettes pattern design

Tileable pattern

Check this great camping tileable pattern design including different camping elements like tents, lamps, wild animals and more! Edit and use this tileable pattern design for your design projects, wallpapers, backgrounds and more

Flat mountain woods landscape

Flat landscape illustration featuring lots of mountains and woods

Cartoon Cruise traveling on the sea

Cartoon Cruise traveling on the sea

Ski colorful design

This beautiful and colorful design show a man skiing making a jump

9 travel emblems

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Flat desert sunset illustration

Flat sunset illustration featuring a desert with cactus

Beach sunset illustration

Flat sunset illustration featuring a beach with palm trees

Sunset beach illustration

Flat sunset illustration featuring a beach with palm trees

Mountain nature landscape

Illustrated nature landscape featuring mountains trees and clouds

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Flat mountain landscape design

Flat winter landscape illustration featuring lots of mountains snow and woods

Hiking silhouette PNG Design

Hiking silhouette

Mountains landscape cut out PNG Design

Mountains landscape cut out

Mountain landscape illustration design

Flat illustration featuring moutains and their reflection

6 Extreme sports badges

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Sunset over mountains illustration

Flat illustration featuring the sun going down behind some mountains and forests

of 33

Boost your businesswith the leading graphic platform for merch