Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

217 mountain hiking Vector Designs for T-Shirts and merch

Download & buy editable mountain hiking AI Vector Graphics Designs for T shirts, Phone Cases, Book Covers and other Merch

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Seeker man illustration

We didn't find any mountain hiking Merch Vectors, but here's all our mountain hiking designs or request design here

Snow mountain climbing silhouette PNG Design

Snow mountain climbing silhouette

Colorful camping scene with mountains illustration design PNG Design

Playful camping illustration featuring a vibrant tent and mountain outline

Mountains Await T-shirt Design

Cool Black and white T-shirt design with a mountain over the clouds illustration

Let's Get Real High T-shirt Design

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Adventure silhouette graphic design with mountains and sun PNG Design

Vibrant poster design featuring a hikers silhouette against a scenic mountain backdrop

Sunrise on the mountains illustration

Low poly illustration featuring moutains and the sun rays coming through them

Mountains resort logo PNG Design

Mountains stroke icon PNG Design

Colorful camping backpack illustration with sunset background design PNG Design

Stylized patch design featuring a detailed hiking backpack with rolled sleeping mat

Colorful camping tent graphic with nature elements t-shirt design PNG Design

Playful graphic design featuring a colorful tent with tree silhouettes, perfect for camping enthusiasts

Playful vintage maple syrup bottle design PNG Design

Colorful lantern with scenic landscape design PNG Design

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Adventure sports zipline design PNG Design

Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Boy on Rock Landscape T-shirt Design

T-shirt design featuring a boy on top of a rock holding a balloon

Climbing mountain silhouette PNG Design

Climbing mountain silhouette

Adventure Awaits Outdoor Experience T-shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Come Away With Me T-shirt Design

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Camping illustrations set

Set of two camping illustrations featuring forest and mountain landscapes

Snow mountain climbing illustration PNG Design

Snow mountain climbing illustration

Mountains journey logo PNG Design

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Dog Trekking T-shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Forever a mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Camping illustrations pack

Set of two camping illustrations featuring forest and mountain landscapes

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

One with the Mountains T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Outdoor landscapes illustration set

Set of two illustrations featuring a forest and icy mountain landscape

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Mountains German quote t-shirt design

Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Illustrated camping set

Set of two camping illustrations featuring mountain and forest landscapes

Playful nature-themed water bottle design PNG Design

Nature Landscape Outdoor Badge Pack

Badge pack featuring two natural landscapes namely tropical island and mountain cabin

Flat forest landscape illustration

Flat landscape illustration featuring a forest mountain and river

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Mountain Vectors

Free mountain vectors illustration in adobe illustrator

Everything For You T-shirt Design

Nice t-shirt design featuring an illustration of couples mountain climbing with "I do everything for you" caption

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Camping icons and elements

Camping is one big way of enjoy life outdoors

Vintage camping water bottle illustration with nature elements PNG Design

Adventure knife and wood illustration design PNG Design

Playful t-shirt design featuring a knife embedded in a log, symbolizing adventure

Camping badge

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Colorful vintage bottle design with tropical leaves art print PNG Design

Playful camping mug design with tree illustration PNG Design

Cheerful digital artwork featuring a yellow camping mug with a tree graphic

Camping survival kit

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Snow and mountains illustrated landscape

Flat illustration featuring a winter landscape with mountains trees and lots of snow

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

of 5

Boost your businesswith the leading graphic platform for merch