Sign Up
Log in
Vexels Logo

91 adventure sport Vector Designs for T-Shirts and merch

Download & buy editable adventure sport AI Vector Graphics Designs for T shirts, Phone Cases, Book Covers and other Merch

Sponsored results byShutterstock Logo
Get 15% off with code: VXL15

Yeti Santa Claus snowboarding adventure t-shirt design

for Mercht-shirt icon
Print ready
Eye-catching t-shirt design featuring a Yeti Santa Claus having a blast while snowboarding

Paragliding avdenture sport t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Awesome t-shirt design featuring a person paragliding and the quote "Speedflying let's shred"

Mountain Climber Adventure Lifestyle T-shirt Design

for Mercht-shirt icon
Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Paragliding sunset t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design that features a person paragliding during the sunset

Life adventure hiking t-shirt design

for Mercht-shirt icon
Print ready
Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Exciting basketball adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Playful t-shirt design with a smiling basketball

Flat water sports surf creator

Editable design featuring tons of different water sports silhouettes and backgrounds to choose from

Skiing goggles t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design with a mountain reflection in ski goggles

Mountain bike vintage t-shirt design

for Mercht-shirt icon
Retro-styled t-shirt design with a mountain bike theme

Bigfoot skiing adventure t-shirt design

for Mercht-shirt icon
Humorous t-shirt design showing a cartoon Bigfoot skiing downhill, blending cryptozoology with winter sports

Skateboarding art t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Captivating t-shirt design with the quote; "Skateboarding: The Art of Defying Gravity"

Skiing penguin t-shirt design

for Mercht-shirt icon
Print ready
Cute t-shirt design with an animated penguin enjoying skiing, perfect for winter sport enthusiasts

E biking adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Check out this cool t-shirt design for electronic bikers including a man riding his bike through the forest and the German quote 'Yes, everything's alright'

Funny hiker quote t-shirt design

for Mercht-shirt icon
Editable text
Print ready
A black t-shirt design with the phrase "Be nice to hikers they know places you'll never be found" in bold, white letters

Ski party crew t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Adventurous t-shirt design showcasing a hen character for a "Ski-Hennen JGA Party Crew", with a ski-themed caricature

Downhill Biking T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a downhill biker and the quote saying DOWHILL IS MY THRILL

Summer beach umbrella t-shirt design

for Mercht-shirt icon
Editable text
Print ready
This playful t-shirt design features a beach umbrella with a striking striped pattern in red and white

Funny Snow Goggles T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

quad bikers hand drawn set

Premiumcrown icon
Black and white hand drawn illustration set that features three professional quad bikers doing jump tricks

Scuba diver exploring the ocean t-shirt design

for Mercht-shirt icon
Print ready
Look at this cool t-shirt including a scuba diver exploring under the sea! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Diver in the ocean t-shirt design

for Mercht-shirt icon
Print ready
Check out this cool t-shirt design of a diver exploring the ocean! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Surfing van t-shirt design

for Mercht-shirt icon
Print ready
Check out this great t-shirt design including a surfing van and some surfboards! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

French accounting book cover design

Premiumcrown icon
Editable text
Print ready
Cool book cover design featuring geometrical diamond shapes

Hiking adventure mountains illustration

Adventure illustration featuring a human silhouette doing hiking

Seven Summits Mountain T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring the seven highest mountain summits

Boots for hiking t-shirt design

for Mercht-shirt icon
Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Paraglider t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design consisting of a person paragliding

Winter sports customizable design

Editable design featuring tons of different winter sports silhouettes and backgrounds to choose from

3 ski sport labels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Retro skiing enthusiast t-shirt design

for Mercht-shirt icon
Retro-style t-shirt design showcasing a dynamic skier silhouette within a circular frame, with the text "I'd rather be skiing"

Mountain biker silhouette t-shirt design

for Mercht-shirt icon
Print ready
Dynamic t-shirt design featuring a silhouette of a mountain biker performing a dab against a vibrant yellow splash backdrop

Hiking tracking log template KDP interior design

for Mercht-shirt icon
Print ready
Cool hiking themed tracking log

Live on tape tight rope t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Look at this cool t-shirt design for tight rope fans including a person's silhouette in a retro sunset background and the quote 'Live on tape'

Sand in my boots hiking t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Check out this cool t-shirt design for people who loves hiking including the quote 'All I brought back with me was sand in my boots'

quad bikers black set

Premiumcrown icon
Black and white illustration set that features three quads and three bikers doing different tricks

6 Extreme sports badges

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Family in the mountains t-shirt design

for Mercht-shirt icon
Print ready
Look at this adorable t-shirt design of a family exploring the mountains! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Nordic skiing t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

atv road badges set

Premiumcrown icon
Set of 6 badges featuring different all-terrain vehicles with quotes that read "of the road" "extreme team" "road adventure" and more! Juego de 6 insignias con diferentes vehiculos todo terreno con citas que dicen "de la carretera" "equipo extremo" "aventura en la carretera" y mas! Conjunto de 6 emblemas com diferentes veiculos todo-o-terreno com citacoes que dizem "da estrada" "equipe extrema" "aventura na estrada" e muito mais! Set mit 6 Abzeichen mit verschiedenen Gelandefahrzeugen mit Zitaten wie "von der Strae" "extremes Team" "Straenabenteuer" und mehr!

Climbing heals the soul t-shirt design

for Mercht-shirt icon
Print ready
Watch this amazing t-shirt design of a woman climbing a stone wall and the quote  'Climbing heals the soul'

Snow ski supervisor t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Sporty t-shirt design with ski goggles reflecting mountains and skier silhouettes, with the text "Skihasen supervisor 1st hour free"

quad bikers illustration set

Premiumcrown icon
Illustration set featuring three colored quads in different positions and bikers doing various tricks

Winter sports holidays banner

Cool flat style winter sports banner with winter elements like ski snowboard gloves and more

Paddle on rafting t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Look at this adventurous t-shirt design including a rafting boat and the quote 'Leave the road & paddle on'

Let's ski t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Dynamic t-shirt design showcasing an intrepid skier

Surfing souls t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Edgy t-shirt design showcasing a zombie surfer riding a wave over multiple skulls with text about surfing souls

quad biker illustration design

Premiumcrown icon
Awesome illustration design that features a man wearing an orange suit and a helmet riding a blue all-terrain vehicle

Surfing intrepid shark t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Dynamic t-shirt design showing a shark riding a surfboard on a wave, with text about breaking rules in the ocean

Bungee jumping silhouette set

Premiumcrown icon
Amazing set comprised of several silhouettes of people practicing bungee jumping, an activity where a person jumps from a great height while connected to a large elastic cord
of 2
Boost your businesswith the leading graphic platform for merch
SEE PLANS