Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

378 hiking PSD T Shirt Designs and Mockups

Download editable hiking PSD t shirt designs or mockups

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Seeker man illustration

We didn't find any hiking PSD Templates, but here's all our hiking designs or request design here

Edit Online Badge

Holiday camping design featuring santa and campfire t-shirt design template

Playful t-shirt design showcasing Santa sitting by a campfire with the text 'Merry Miles on the Trail'

Detailed military-style boot illustration PNG Design

Sturdy illustration of classic military boots featuring intricate detailing and laces

Bold military-style boots illustration design PNG Design

Bold illustration of combat boots featuring intricate lacing and detailed textures

Stylish tribal boot print design PNG Design

Unique boot print design showcases intricate tribal patterns for footwear aesthetics

Stylish illustration of detailing on combat boots PNG Design

Playful graphic design highlighting intricate details of combat boots

Stylish vintage boot illustration PNG Design

Unique vintage boot design showcasing intricate lacing and detailed contours

Detailed combat boot illustration PNG Design

Sturdy boot design featuring intricate lacing details and a robust style

Detailed lantern illustration with mountain landscape PNG Design

Unique lantern design featuring a scenic mountain landscape inside

Oil lamp design featuring scenic mountain illustration PNG Design

Charming illustration in a lantern showing mountains and a sun motif

Colorful lantern with scenic landscape design PNG Design

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Playful footwear graphic design PNG Design

Whimsical design featuring stylized legs in boots, creating a fun and quirky look

Charming winter boots illustration PNG Design

Playful graphic design of winter boots featuring fluffy cuffs and buckles

Cozy winter boots illustration PNG Design

Charming illustration of winter boots, featuring a soft fur top and detailed laces

Stylish red footprint design PNG Design

Dynamic footprint design featuring bold red soles and striking star patterns

Unique sneaker silhouette design PNG Design

Minimalist sneaker design featuring a detailed outline of a shoe's sole

Stylish footwear print design PNG Design

Bold graphic design featuring detailed shoe prints with star patterns, perfect for apparel or merchandise

Distinctive shoe sole pattern graphic design PNG Design

Bold graphic design featuring detailed shoe prints, ideal for outdoor and adventure themes

Unique sneaker tread illustration PNG Design

Stylish graphic design featuring a detailed sneaker footprint pattern

Unique shoe print graphic design PNG Design

Bold shoe print design featuring detailed tread patterns that showcase a rugged outdoor vibe

Edit Online Badge

Vintage mountain quote design t-shirt design template

Rustic and bold, this poster design features an engaging quote that reads, 'Die Berge Haben Mich Gerufen & Ich Muss Gehen!' The typography combines playful script and vintage-inspired fonts, showcasing a strong emphasis on the word 'Berge,' which translates to 'mountains

Adventure-themed compass illustration with motivational quote PNG Design

Playful compass design that serves as a poster illustration

Mountain camping scene design PNG Design

This t-shirt design features a beautiful mountain camping scene with a tent, a campfire, and a moon in the background

Green lamp with mountain scenery design PNG Design

This t-shirt design features a green lamp with a mountain scenery inside

Mountain climber PNG Design

Mountain climber

Mountain label badge with sun PNG Design

Mountain label badge with sun

Green forest landscape with deer

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

12 traveling emblems

12 travel emblems including motivating messages

Lovely Vector Bicycles

Collection of 11 different people riding bicycles silhouettes with

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Mountain climber silhouette 3 PNG Design

Mountain climber silhouette 3

Flat mountain woods landscape

Flat landscape illustration featuring lots of mountains and woods

9 travel emblems

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Flat mountain landscape design

Flat winter landscape illustration featuring lots of mountains snow and woods

Mountain landscape illustration design

Flat illustration featuring moutains and their reflection

Climbing mountain silhouette PNG Design

Climbing mountain silhouette

Flat nature landscape design

Flat landscape illustration featuring lots of hills fields and woods

Forest landscape illustration with snow

Flat illustration featuring a forest with falling snow and bokeh

Illustration of a forest landscape

Flat landscape illustration featuring lots of trees field and river

Camping landscape illustration with campfire

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Forest and mountains landscape with deer

Flat landscape illustration featuring lots of trees mountains and a deer

Mountain landscape illustration

Flat illustration featuring moutains over a blue sky

Forest sunset illustration landscape

Flat landscape illustration featuring a forest with light coming through the tree branches

Mountains resort logo PNG Design

Winter forest landscape illustration

Flat winter illustration featuring a forest with some falling snow

Sunrise on the mountains illustration

Low poly illustration featuring moutains and the sun rays coming through them

Flat forest landscape illustration

Flat landscape illustration featuring a forest mountain and river

Mountain with snow landscape illustration

Flat winter landscape illustration featuring lots of mountains snow and some woods

Outdoor activities editable badges set

Incredible set of 21 editable badges/labels for outdoor activities in cut out style

Flat forest illustration with sun

Flat landscape illustration featuring lots of trees and the sun coming through the branches

of 8

Boost your businesswith the leading graphic platform for merch