Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

198 mountain hiking PNG and SVG design graphic

Download mountain hiking PNG & SVG Designs with transparent background for T-Shirts, book covers, phone cases and other merch.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Seeker man illustration

We didn't find any mountain hiking PNGs For Merch, but here's all our mountain hiking designs or request design here

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Mountains Await T-shirt Design

Cool Black and white T-shirt design with a mountain over the clouds illustration

Mountains German quote t-shirt design

Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Forever mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Dog Trekking T-shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Come Away With Me T-shirt Design

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Mountains resort logo PNG Design

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Mountains stroke icon PNG Design

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Vintage camping water bottle illustration with nature elements PNG Design

One with the Mountains T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Adventure Awaits Outdoor Experience T-shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Sunrise on the mountains illustration

Low poly illustration featuring moutains and the sun rays coming through them

Mountains journey logo PNG Design

Boy on Rock Landscape T-shirt Design

T-shirt design featuring a boy on top of a rock holding a balloon

Flat illustrated landscape set

Set of landscapes featuring different sceneries such as a desert mountains frozen landscapes full of snow and city streets with many buildings

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Forever a mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Camping illustrations set

Set of two camping illustrations featuring forest and mountain landscapes

Diving and alpinism banners

Flat silhouette style of banners: diving and alpinism in plain colors

Camping illustrations pack

Set of two camping illustrations featuring forest and mountain landscapes

Let's Get Real High T-shirt Design

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Outdoor landscapes illustration set

Set of two illustrations featuring a forest and icy mountain landscape

Illustrated camping set

Set of two camping illustrations featuring mountain and forest landscapes

Landscape Badge Design Pack

Badge design pack featuring two landscape design badges including natural landscapes

Flat forest landscape illustration

Flat landscape illustration featuring a forest mountain and river

Nature Landscape Badge Pack

Badge pack featuring two nature landscape designs namely a tropical island seen from the sea and a hut between mountains

Mountain Vectors

Free mountain vectors illustration in adobe illustrator

Adventure sports zipline design PNG Design

Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Camping badge

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

Camping survival kit

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

Snow and mountains illustrated landscape

Flat illustration featuring a winter landscape with mountains trees and lots of snow

Camping icons and elements

Camping is one big way of enjoy life outdoors

Winter snow landscape illustration

Winter illustration featuring a winter landscape with mountains trees a river and lots of snow

Winter landscape illustration with deer

Winter illustration featuring a winter landscape with silhouettes of a deer trees and lots of snow

2 outdoors forest illustration banners or frames

Set of two camping illustrations featuring forest landscapes

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Climbing colorful design

This vectors shows a young man climbing on a limesonte wall with colorful abstract design

Climbing motivation metaphor

Rock climbing girl with beautiful twilight sundown on the background

Travel backpack colored stroke icon PNG Design

Camping label

Camping label or seal displaying a tent in a park with mountains

Trekking Travel illustration design

2 men tracking mountains

Climbing mountains t-shirt design

Merchandise design that works great on tshirts posters hats and more

9 travel emblems

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Winter Trekking People Silhouette

People silhouette featuring two hikers in a winter landscape

12 traveling emblems

12 travel emblems including motivating messages

of 4

Boost your businesswith the leading graphic platform for merch