Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

2038 adventure designs graphics for t-shirt and print on demand merch

Download adventure t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

Nautical lighthouse design with wave and porthole PNG Design

Vibrant t-shirt design featuring a lighthouse framed by a porthole and crashing wave

Born to travel t-shirt design

Amazing t-shirt design that features an illustration of a map in watercolor style with the quote "Born to travel"

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Seven Summits Mountain T-shirt Design

T-shirt design featuring the seven highest mountain summits

Vintage camping water bottle illustration with nature elements PNG Design

Let's read quote color stroke PNG Design

Let's read quote color stroke

Just one more chapter reading quote semi flat PNG Design

Just one more chapter reading quote semi flat

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Minimalist mountain and pet outline design PNG Design

Elegant poster design featuring a figure and cat silhouetted against mountains

Vintage lighthouse nautical design PNG Design

Bold emblem design featuring a lighthouse, waves, and rope elements

Playful nature-themed water bottle design PNG Design

Stylized lighthouse and seabird nautical graphic design PNG Design

Classic emblem style graphic showcasing a lighthouse and seagull within a ship's wheel

Vintage mountain water bottle design PNG Design

Nautical lighthouse design with ship's wheel PNG Design

Playful illustration featuring a lighthouse and waves within a ship's wheel

Nature-inspired water bottle design with mountain and night sky elements PNG Design

Charming sticker design featuring a yellow water bottle with a nature motif and a moonlit backdrop

Vintage nautical lighthouse and steering wheel illustration design PNG Design

Charming poster design featuring a lighthouse, seagull, and nautical wheel elements

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Vintage hiking water bottle design PNG Design

Playful sticker design featuring a vintage-style water bottle and mountain elements

Unique bottle design with mountain motif PNG Design

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Intricate weapon design with hooks and chains PNG Design

Bold illustration showcasing intricately designed hooks connected by chains

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Colorful whimsical character design with oversized hat and beard, t-shirt design PNG Design

Charming digital illustration of a gnome with a long beard and a pointy hat

Cute whimsical character design with braided hair and oversized hat t-shirt design PNG Design

Charming digital illustration featuring a whimsical gnome with braided hair and a large hat

Downhill Biking T-shirt Design

T-shirt design featuring a downhill biker and the quote saying DOWHILL IS MY THRILL

Colorful whimsical gnome character design PNG Design

Whimsical digital illustration of a gnome with a large hat and bushy beard

Playful gnome character design with a winter theme PNG Design

Charming gnome illustration featuring a friendly expression and cozy attire

Whimsical fantasy creature illustration with cozy hat design PNG Design

Charming cartoon character design featuring a whimsical wizard with a cozy hat and flowing robe

Space exploration logo set

Charming gnome character waving illustration t-shirt design PNG Design

Charming gnome design featuring a whimsical green hat and round belly, perfect for festive themes

Charming whimsical character design with vibrant colors and playful details t-shirt design PNG Design

Charming digital illustration of a whimsical gnome with a big beard and colorful hat

Whimsical gnome character illustration with bright colors for playful design PNG Design

Charming cartoon gnome design featuring a whimsical hat and curly beard

Boots for hiking t-shirt design

Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Whimsical character with a colorful hat illustration t-shirt design PNG Design

Charming illustration of a gnome wearing a pink hat and flowing robe, featuring intricate beard details

Whimsical gnome illustration with colorful hat design PNG Design

Charming cartoon gnome with a bright hat and whimsical features, perfect for playful themed items

Whimsical character illustration featuring a gnome with a colorful hat t-shirt design PNG Design

Charming digital art featuring a quirky gnome with a long beard and oversized hat

Cute gnome character with heart balloon illustration for t-shirt design PNG Design

Charming illustration featuring a gnome with a heart balloon, perfect for festive designs

Camper van hand drawn t-shirt design

Awesome black and white design featuring a hand-drawn camper van parked on the beach, and the quote "Home is where you park it"

Adorable gnome character with colorful hat design t-shirt design PNG Design

Charming digital illustration of a gnome with a long beard and whimsical hat

Whimsical green-hatted character illustration t-shirt design PNG Design

Charming illustration of a gnome with a tall hat, detailed beard, and friendly pose

Whimsical character illustration with oversized hat t-shirt design PNG Design

Charming gnome illustration featuring a whimsical hat and a long beard

Take me to mountains t-shirt design

Amazing t-shirt design featuring the quote "Take me to the mountains"

Whimsical bearded character in straw hat illustration t-shirt design PNG Design

Charming character design featuring a gnome with a straw hat and cheerful expression

Playful gnome character design with straw hat PNG Design

Adorable illustration featuring a whimsical gnome with a straw hat and long beard

Charming folk character with straw hat illustration t-shirt design PNG Design

Charming character design featuring a whimsical gnome with a straw hat and beard

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Whimsical character design with straw hat and flowing robe t-shirt design PNG Design

Whimsical design featuring a wizard with a straw hat and flowing beard, perfect for illustrations or merchandise

Family road trip palms design PNG Design

Family road trip palms design

of 41

Boost your businesswith the leading graphic platform for merch