Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

1730 adventure designs graphics for t-shirt and print on demand merch

Download adventure t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Playful flamingo beach style design PNG Design

Vibrant and playful, this graphic design features a whimsical pink flamingo soaring through a starry sky

Edit Online Badge

Futuristic canine troop design featuring a space dog t-shirt design template

Bold digital illustration showcasing a stylized dog character wearing advanced headphones and a sleek helmet

Edit Online Badge

Retro video game art featuring space monsters t-shirt design template

Playful t-shirt design showcasing vibrant illustrations of space monsters and a heroic character

Edit Online Badge

Elegant free bird quote design t-shirt design template

Striking and whimsical, this poster design features two birds in flight, symbolizing freedom

Edit Online Badge

Intricate moose skull design with nature theme t-shirt design template

Striking and detailed, this t-shirt design features an intricate illustration of a moose skull adorned with foliage and antlers

Edit Online Badge

Playful horse cycling design with motivational quotes t-shirt design template

Dynamic and playful, this t-shirt design features a cartoon horse character energetically riding a bicycle

Fantasy princess and unicorn coloring page PNG Design

Playful coloring page featuring a whimsical princess riding a unicorn

Edit Online Badge

Tulum beach paradise travel poster t-shirt design template

Vibrant travel poster design showcasing Tulum's enchanting seaside landscape

Edit Online Badge

Rally car design with bold typography t-shirt design template

Dynamic rally car design featuring a classic racing vehicle in motion

Edit Online Badge

Space voyage astronaut design t-shirt design template

Bold graphic design featuring an astronaut in a space suit, surrounded by a globe motif

Edit Online Badge

Astronaut surfing graphic design t-shirt design template

Playful and adventurous, this poster design features an astronaut skillfully surfing a vibrant wave

Edit Online Badge

Charming bonfire quote design t-shirt design template

Playful t-shirt design featuring the quote 'Life is better by a bonfire'

Powerful warrior with electric guitar design PNG Design

Dynamic and bold, this illustration features a muscular warrior raising an electric guitar that resembles a weapon

Playful cartoon snowboarder design PNG Design

Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Artistic illustration of submerged figures in water PNG Design

Contemporary and evocative, this poster design features a unique depiction of two legs sticking out of the water, surrounded by submerged heads

Whimsical heart balloon design PNG Design

Playful hot air balloon design featuring vibrant pink colors and detailed heart motifs

Playful scooter design with flaming wheels PNG Design

Vibrant and playful, this digital illustration features a scooter in bold pink, complete with fiery flames shooting from its wheels

Camper van hand drawn t-shirt design

Awesome black and white design featuring a hand-drawn camper van parked on the beach, and the quote "Home is where you park it"

Pile of three books doodle PNG Design

Pile of three books doodle

Hiking man silhouette PNG Design

Hiking man silhouette

Camping adventures axe quote t-shirt design

Look at this awesome camping t-shirt design including an axe and forest illustration with the quote 'Camping adventures'

Camping heart t-shirt design

Lovely t-shirt design that features a heart filled with camping elements in doodle style

Vintage airship graphic design PNG Design

Sleek and minimalist, this design features a vintage airship rendered in a bold dark blue against a light gray background

Green forest landscape with deer

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Cool truck quote t-shirt design

Amazing travel t-shirt design of a truck and the quote 'Let's start the journey'

Seven Summits Mountain T-shirt Design

T-shirt design featuring the seven highest mountain summits

Take me to mountains t-shirt design

Amazing t-shirt design featuring the quote "Take me to the mountains"

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Cruise cut out PNG Design

Cruise cut out

Born to travel t-shirt design

Amazing t-shirt design that features an illustration of a map in watercolor style with the quote "Born to travel"

Princess of skis German t-shirt design

This awesome ski t-shirt design includes a pair of ski goggles, some mountains and the German quote 'Princess of ski'

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Camping silhouettes pattern design

Tileable pattern

Check this great camping tileable pattern design including different camping elements like tents, lamps, wild animals and more! Edit and use this tileable pattern design for your design projects, wallpapers, backgrounds and more

Flat mountain woods landscape

Flat landscape illustration featuring lots of mountains and woods

Cartoon Cruise traveling on the sea

Cartoon Cruise traveling on the sea

Gone hunting t-shirt design

Check out this cool hunting t-shirt design featuring a deer and fish and the quote 'Gone hunting be back soon to go fishing'

Boots for hiking t-shirt design

Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Ski colorful design

This beautiful and colorful design show a man skiing making a jump

9 travel emblems

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Straight Outta Skydiving T-shirt Design

Straight Outta Skydiving T-shirt Design depicting a skydiver falling with an open parachute and the phrase STRAIGHT OUTTA SKYDIVING as parody of NWA's STRAIGHT OUTTA COMPTON album

Flat desert sunset illustration

Flat sunset illustration featuring a desert with cactus

Beach sunset illustration

Flat sunset illustration featuring a beach with palm trees

Sunset beach illustration

Flat sunset illustration featuring a beach with palm trees

Mountain nature landscape

Illustrated nature landscape featuring mountains trees and clouds

Yellowstone national park usa t-shirt design

This beautiful t-shirt design includes a landscape of Yellowstone and the quote 'Yellowstone National Park'

Reading dragon fantasy t-shirt design

Look at this incredible t-shirt design of a red dragon reading a magic book! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Flat mountain landscape design

Flat winter landscape illustration featuring lots of mountains snow and woods

Hiking silhouette PNG Design

Hiking silhouette

Mountains landscape cut out PNG Design

Mountains landscape cut out

of 35

Boost your businesswith the leading graphic platform for merch