Sign Up
Log in
Vexels Logo

173 adventure sport designs graphics for t-shirt and print on demand merch

Download adventure sport t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results byShutterstock Logo
Get 15% off with code: VEXELS15

Paragliding avdenture sport t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Awesome t-shirt design featuring a person paragliding and the quote "Speedflying let's shred"
Edit Online BadgeEdit Online

Playful pool ball adventure quote t-shirt design template

Charming poster design featuring a whimsical character with the text 'Chilling Eight' and 'Next chapter on to the next adventure'

Hiking adventure mountains illustration

Adventure illustration featuring a human silhouette doing hiking

Mountain Climber Adventure Lifestyle T-shirt Design

for Mercht-shirt icon
Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Life adventure hiking t-shirt design

for Mercht-shirt icon
Print ready
Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

3 ski sport labels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written
Edit Online BadgeEdit Online

Playful dog canoeing adventure illustration t-shirt design template

Charming t-shirt design featuring a playful dog paddling in a canoe

Bigfoot skiing adventure t-shirt design

for Mercht-shirt icon
Humorous t-shirt design showing a cartoon Bigfoot skiing downhill, blending cryptozoology with winter sports

Mountain bike sport t-shirt design

for Mercht-shirt icon
Dynamic t-shirt design showing a mountain biker with the text: "Adrenaline is my life"

Dynamic mountain adventure silhouette t-shirt design PNG Design

Premiumcrown icon
Dynamic climbing illustration featuring a climber against a mountain backdrop

Stylish climbing adventure landscape graphic design PNG Design

Premiumcrown icon
Dynamic poster design featuring a climber against a vibrant sunset, showcasing an outdoor spirit

Hiking adventure silhouette PNG Design

Premiumcrown icon
Hiking adventure silhouette

Hillwalking adventure PNG Design

Premiumcrown icon
Hillwalking adventure

E biking adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Check out this cool t-shirt design for electronic bikers including a man riding his bike through the forest and the German quote 'Yes, everything's alright'

Mountain biking adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Striking t-shirt design with a mountain biker against a backdrop of towering mountains and the phrase "Mountains are calling

Atv mountain adventure badge PNG Design

Atv mountain adventure badge

Slackline sport silhouette PNG Design

Premiumcrown icon
Slackline sport silhouette

Exciting basketball adventure t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Playful t-shirt design with a smiling basketball

Paragliding sunset t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design that features a person paragliding during the sunset
Edit Online BadgeEdit Online

Playful helmet design with cherry motif and motivational quotes t-shirt design template

Whimsical helmet design featuring a cherry as the focal point, ideal for sports enthusiasts

Whimsical dog illustration with vintage accessories PNG Design

Premiumcrown icon
Playful and charming, this digital illustration features two adorable dogs adorned with quirky vintage accessories
Edit Online BadgeEdit Online

Vintage mountain escape ski poster design t-shirt design template

Charming vintage poster design featuring a female skier ready for adventure
Edit Online BadgeEdit Online

Dynamic racing quote design t-shirt design template

Bold t-shirt design featuring a high-energy racing car mid-jump
Edit Online BadgeEdit Online

Vintage montana clothing logo design with inspirational quote t-shirt design template

Charming apparel design featuring the word 'Montana' prominently displayed in a bold arch

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Mountaineering holidays background

This background shows the silhouettes of two men walking with big backpacks in a mountaineering adventure

Mountain climb man poster

This poster shows the silhouette of a man climbing a mountain with other mountains covered in snow behind him

Alpinism woman design

This vector shows the silhouette of a woman doing alpinism with some mountains covered in snow behind her

Rafting club logo template

Rafting label featuring a silhouette practising the sport and paddles along text that says rafting club

Karting Vector

Go kart racing vector graphics of carting racer in action outdoor in the streets on graphic background with skyscraper city buildings arrow traffic light dots and shattered shapes

Mountain bike vintage t-shirt design

for Mercht-shirt icon
Retro-styled t-shirt design with a mountain bike theme

atv road badges set

Premiumcrown icon
Set of 6 badges featuring different all-terrain vehicles with quotes that read "of the road" "extreme team" "road adventure" and more! Juego de 6 insignias con diferentes vehiculos todo terreno con citas que dicen "de la carretera" "equipo extremo" "aventura en la carretera" y mas! Conjunto de 6 emblemas com diferentes veiculos todo-o-terreno com citacoes que dizem "da estrada" "equipe extrema" "aventura na estrada" e muito mais! Set mit 6 Abzeichen mit verschiedenen Gelandefahrzeugen mit Zitaten wie "von der Strae" "extremes Team" "Straenabenteuer" und mehr!

Rafting silhouette logo template

Rafting logo featuring a silhouette practising the sport along text that says rafting fastwater adventures

Skiing penguin t-shirt design

for Mercht-shirt icon
Print ready
Cute t-shirt design with an animated penguin enjoying skiing, perfect for winter sport enthusiasts

Hipster Rafting Label

Rafting logo featuring a drawing of a person practising the sport along text that says rafting

Cliff jumping t-shirt design

Premiumcrown icon
Editable text
Print ready
Dynamic t-shirt design with the text 'Cliff Jumping' over a stark cliff seascape, capturing the thrill of the sport

Blue icon of a person on a surfboard PNG Design

Premiumcrown icon
A blue icon depicts a person riding a surfboard, capturing the essence of the thrill and adventure of surfing

Jet ski icon simple PNG Design

Premiumcrown icon
A stylized icon of a jet ski depicted with a dynamic shape and vibrant colors, representing the excitement and thrill of the popular water sport

Line icon of a snowboarder riding a wave PNG Design

Premiumcrown icon
A black and white line icon showcasing a snowboarder skillfully riding a snowy wave, capturing the essence of winter sports and adventure

Playful cartoon snowboarder design PNG Design

Premiumcrown icon
Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Silhouette of a person paragliding PNG Design

Premiumcrown icon
A striking silhouette of a person gracefully soaring through the sky while paragliding, capturing the thrilling essence of the sport

Stylized all-terrain vehicle illustration design PNG Design

Premiumcrown icon
Dynamic and playful, this vector graphic design features a detailed illustration of a quad bike

Dynamic off-road vehicle illustration PNG Design

Premiumcrown icon
Stylish off-road vehicle design, perfect for automotive enthusiasts

Equestrian inspired horse t-shirt design

for Mercht-shirt icon
Print ready
Playful t-shirt design featuring a horse graphic with the quote 'Ride Fast Live Free

Stylized shield design with vibrant sunset and claw marks for sports branding PNG Design

Premiumcrown icon
Striking logo design featuring a shield shape, claw marks, and a central sun motif

Equestrian saddle up and ride design PNG Design

Premiumcrown icon
Playful t-shirt design featuring a rearing horse with the phrase 'Saddle Up & Ride' prominently displayed

Snow ski supervisor t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Sporty t-shirt design with ski goggles reflecting mountains and skier silhouettes, with the text "Skihasen supervisor 1st hour free"

Retro skiing enthusiast t-shirt design

for Mercht-shirt icon
Retro-style t-shirt design showcasing a dynamic skier silhouette within a circular frame, with the text "I'd rather be skiing"

Bold motorcycle outline graphic design PNG Design

Premiumcrown icon
Bold motorcycle illustration design featuring a sleek and detailed profile of a classic bike
Edit Online BadgeEdit Online

Dynamic skateboarding graphic design t-shirt design template

Vibrant skateboard design showcasing a stylized skateboarder in action
of 4
Boost your businesswith the leading graphic platform for merch
SEE PLANS