Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

1576 mountain Logo Design Templates

Download editable mountain Logo Design Templates

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Seeker man illustration

We didn't find any mountain Logos, but here's all our mountain designs or request design here

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Silhouetted desert scene with clouds and cactus t-shirt design PNG Design

Sleek poster design featuring stylized mountains, clouds, and a sun with a cactus silhouette

Minimalist line art of a mother and child in nature PNG Design

Elegant line art design showcasing a mother holding hands with her child, depicting a serene outdoor scene

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Retro minimalist landscape t-shirt design

Aesthetic t-shirt design featuring a stylized mountain landscape within a circular frame with the phrase "Into the Wild"

Great smoky mountains national park t-shirt design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

Stylized monochrome desert scenery with cacti t-shirt design PNG Design

Stylish poster design featuring abstract cacti and rolling hills in a minimalist style

Mountains under the sun t-shirt design

Cool t-shirt design featuring a mountain, the sun and a road

Rock Mountain Or Hill Climibing clip art

Abstract black and white style artwork of a male character climbing rock mountain

Anime snowboarding t-shirt design

Cool t-shirt design featuring an anime boy character snowboarding down a mountain

Ski jumper winter sport t-shirt design

Amazing t-shirt design featuring a person skiing down a mountain

Hill mountain stroke PNG Design

Hill mountain stroke

Black & White Abstract Mountains Pack

Cool looking set of various mountains and hills with various shade silhouette iconic artistic sketchy line art and other abstract styles in black and white color scheme

Cloudy Mountain Design Set

Design set featuring various mountain ridges

Camping badge

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

Man with metal detector silhouette t-shirt design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Pile of books author craft t-shirt design

Stunning t-shirt design featuring a mountain of books with the quote "Write without fear, edit without mercy"

Adventure Awaits Outdoor Experience T-shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Bear geometric t-shirt design

Nice nature theme t-shirt design featuring a bear in the forest with water reflection and the moon above made with geometric shapes

3 ski sport labels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Wilderness Love Tshirt Design

Nature themed T-shirt design showing a view of the mountains with a big "Wilderness" and "love" caption in different font styles

Hate People T-shirt Design

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

Viking Compass T-shirt Design

Viking Compass T-shirt Design featuring a detailed illustration of a viking compass with viking symbols on it an some mountains and moon on its back

Mudding car quote t-shirt design

Awesome t-shirt design featuring a mountain and a car next to a quote that reads "I go mudding"

Dabbing Yeti Sunset Funny Meme T-shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

Gnome cartoon on snowboard t-shirt design

Amazing t-shirt design featuring a gnome snowboarding down a mountain

Frog life cycle t-shirt design

Cool t-shirt design that features a simple mountain and the quote "Mount Kosciuzco"

Mountains adventure quote t-shirt design

Inspirational t-shirt design with a mountain landscape and the quote: "The mountains are calling me"

Winter vacation funny t-shirt design

Amazing t-shirt design featuring a person going down a mountain in the snow and the quote "Paradise doesn't have to be tropical"

Person cycling retro sunset t-shirt design

Cool t-shirt design featuring a person riding a bike against a mountain and retro sunset background with the quote "Cicyling at dawn"

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Snowmobile and mountains t-shirt design

Funny t-shirt design featuring a person with a snowmobile with a mountain and retro sunset background

Snowboarding sport athlete t-shirt psd

Amazing t-shirt psd that features a person snowboarding with the quote "Snow and mountain"

Ski in the Snowy Mountain

Cool illustration of a snowy mountain landscape with a guy skiing and mountain cabin

Life adventure hiking t-shirt design

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Travel lifestyle line art phone case set

Cool phone case set that features scenes about traveling like a backpack and a mountain

Santa Claus with presents t-shirt design

Awesome t-shirt design that features santa claus driving a car down a mountain with a gift bag and the quote "Santa's special delivery"

Colorful strokes Seattle skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

Vintage camping water bottle illustration with nature elements PNG Design

The melody of the Alps touristic t-shirt design

Check this great t-shirt design including the German quote 'The melody of the Alps' and a mountain man playing an Alps horn

2015 Year of Goat polygon poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Santa Claus Ski Christmas Background

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Child skying cartoon t-shirt design

Cool t-shirt design featuring a child skying down a mountain in cartoon style

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Happy camper t-shirt design

Cool camping theme t-shirt design featuring a "Happy camper" caption the A letter is replaced with a tent with various camping elements scattered around Genial dise?o de camiseta con tema de acampada con una leyenda "Feliz campista" la letra A se reemplaza por una tienda de campa?a con varios elementos de acampada esparcidos alrededor O design legal de uma camiseta com o tema camping com a legenda "Campista feliz" a letra A foi substitu?da por uma barraca com v?rios elementos de acampamento espalhados ao redor Cooles T-Shirt-Design zum Thema Camping mit der Aufschrift "Happy Camper"

Smoky Mountains T-shirt Design

T-shirt design about Smoky Mountains featuring a road pines and a rocky landscape in a sunset and the words SMOKY MOUNTAINS

Utah Climbing T-shirt Design

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Faith can move mountains Christian quote PNG Design

A majestic mountain range stands tall as the sun begins to set, with rays of light shining through the clouds, depicting the power of faith

Boost your businesswith the leading graphic platform for merch