Sign Up
Log in
Vexels Logo

489 adventure Vectors & Graphics to Download

Download adventure editable vector graphics for every design project. In AI, SVG, PNG, JPG and PSD.

Sponsored results byShutterstock Logo
Get 15% off with code: VEXELS15

Jalisco city t-shirt design

for Mercht-shirt icon
Print ready
Awesome Jalisco city t-shirt design

Surfing van t-shirt design

for Mercht-shirt icon
Print ready
Check out this great t-shirt design including a surfing van and some surfboards! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Underwater cities t-shirt design

for Mercht-shirt icon
Print ready
Check out this cool t-shirt design of a vintage diving man surrounded by giant tentacles and the quote 'Exploring underwater cities'

Mainau Germany t-shirt design

for Mercht-shirt icon
Print ready
This cool t-shirt design includes plant motifs and the quote 'Mainau'

Funny hiker quote t-shirt design

for Mercht-shirt icon
Editable text
Print ready
A black t-shirt design with the phrase "Be nice to hikers they know places you'll never be found" in bold, white letters

Vintage cowboy and truck t-shirt design

for Mercht-shirt icon
Print ready
Captivating t-shirt design with a classic western scene featuring a cowboy and vintage truck

Couple holding hands mug design

for Mercht-shirt icon
Editable text
Print ready
Beautiful mug design featuring a silhouette of a couple holding hands at with a mountain in the background

Canoe river landscape t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design with a canoe in line art style, floating on a serene blue lake surrounded by trees and hills

Skiing goggles t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design with a mountain reflection in ski goggles

Skiing penguin t-shirt design

for Mercht-shirt icon
Print ready
Cute t-shirt design with an animated penguin enjoying skiing, perfect for winter sport enthusiasts

Skateboarding art t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Captivating t-shirt design with the quote; "Skateboarding: The Art of Defying Gravity"

Gnome walking with backpack t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Fun t-shirt design featuring a gnome walking with a backpack and the quote "So much world to see, many adventures to come"

Nordic skiing t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

Forest runner t-shirt design

for Mercht-shirt icon
Eye-catching t-shirt design depicting a man running through a forest with a dramatic, moody atmosphere

Skull in poison bottle t-shirt design

for Mercht-shirt icon
Print ready
Charming t-shirt design featuring an animated scene of sea creatures around a skull inside a poison bottle

Man in a boat japanese t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design, featuring a man sitting in a boat, with the sun shining behind him

Trail running sloth t-shirt design

for Mercht-shirt icon
Print ready
Check this cool t-shirt design of a trail running sloth! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Travelers badge t-shirt design

for Mercht-shirt icon
Vintage-inspired t-shirt design featuring a travelers badge with customizable text areas

Magical nature discovery t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Vibrant t-shirt design showcasing a joyful leafy creature with the quote: "Discover the magic of nature

Camper van hand drawn t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Awesome black and white design featuring a hand-drawn camper van parked on the beach, and the quote "Home is where you park it"

Born to travel t-shirt design

for Mercht-shirt icon
Print ready
Amazing t-shirt design that features an illustration of a map in watercolor style with the quote "Born to travel"

Family in the mountains t-shirt design

for Mercht-shirt icon
Print ready
Look at this adorable t-shirt design of a family exploring the mountains! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Sinaloa state landscape t-shirt design

for Mercht-shirt icon
Print ready
Awesome mexican t-shirt design of Sinaloa state

Astronaut on bike space t-shirt design

for Mercht-shirt icon
Print ready
Intriguing t-shirt design featuring an astronaut riding a bike in space

Downhill Biking T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a downhill biker and the quote saying DOWHILL IS MY THRILL

Adventurous pirate parrot t-shirt design

for Mercht-shirt icon
Print ready
Funny t-shirt design featuring an adventurous pirate parrot with a playful expression, evoking a sense of daring and excitement

Live on tape tight rope t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Look at this cool t-shirt design for tight rope fans including a person's silhouette in a retro sunset background and the quote 'Live on tape'

Take me to mountains t-shirt design

for Mercht-shirt icon
Print ready
Amazing t-shirt design featuring the quote "Take me to the mountains"

Adventurous cat climbing t-shirt design

for Mercht-shirt icon
Print ready
Whimsical t-shirt design depicting a cat in a backpack climbing a colorful rock wall

Monochrome scuba diver with bubbles t-shirt design

for Mercht-shirt icon
Whimsical t-shirt design depicting an astronaut in scuba gear floating through space bubbles

Paragliding sunset t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design that features a person paragliding during the sunset

Retro travel journal template KDP interior design

Premiumcrown icon
Editable text
Print ready
These great journal travel interior design pages come in a retro presentation ideal for 80's lovers! Self-publish on KDP with this printable journal template

Utah Climbing T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Majestic winter landscape t-shirt design

for Mercht-shirt icon
Print ready
Dramatic t-shirt design showcasing a majestic winter landscape

Seven Summits Mountain T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring the seven highest mountain summits

Little boy diving t-shirt design

for Mercht-shirt icon
Print ready
Playful t-shirt design with a cartoon of a boy pretending to dive in a bathtub

DnD dice treasure phone case design

for Mercht-shirt icon
Print ready
Seamless phone case design featuring repeating pixeled patterns of treasure chests and D20 dice on a blue background, inspired by tabletop roleplaying games

Boots for hiking t-shirt design

for Mercht-shirt icon
Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Sexy and outdoorsy t-shirt design

for Mercht-shirt icon
Print ready
Great t-shirt design featuring a car towing a caravan with a retro background

Your own way t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Nice t-shirt design featuring the quote "Go your own way" and wooden signs with different captions

Let's ski t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Dynamic t-shirt design showcasing an intrepid skier

Space exploration logo set

Collection of four space exploration logos featuring two space shuttle planet and astronaut logos with "Explore the galaxy" "Space adventure" and "Space exploration" slogans Coleccion de cuatro logotipos de exploracion espacial con dos logotipos de astronautas y planetas del transbordador espacial con los esloganes "Explora la galaxia", "Aventura espacial" y "Exploracion espacial"

Zanzibar surfer t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Cool t-shirt design that features a surfboard and palmtrees

Astronaut riding a motorcycle t-shirt design

for Mercht-shirt icon
Print ready
Eye-catching t-shirt design showcasing an astronaut riding a motorcycle, combining the thrill of space exploration with the excitement of the open road

Explore the unknown mountain t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Cool t-shirt that features a t-shirt design that reads "Explore the unknown" in bold letters against a mountain background

Detailed pirate face t-shirt design

for Mercht-shirt icon
Print ready
Captivating t-shirt design portraying a detailed pirate face with a menacing look and pirate hat

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Fantasy dice t-shirt design

for Mercht-shirt icon
Print ready
Artistic t-shirt design with fantasy dice surrounded by floral elements

Alien sunset t-shirt design

for Mercht-shirt icon
Print ready
Dynamic t-shirt design showcasing an alien with a stunning sunset backdrop, set against a landscape of city towers and palm trees

quad biker illustration design

Premiumcrown icon
Awesome illustration design that features a man wearing an orange suit and a helmet riding a blue all-terrain vehicle
of 10
Boost your businesswith the leading graphic platform for merch
SEE PLANS