Pricing
Sign Up
Log in
Vexels Logo
Class of 2026

142 climbing Vector Designs for T-Shirts and merch

Download & buy editable climbing AI Vector Graphics Designs for T shirts, Phone Cases, Book Covers and other Merch

Sponsored results byShutterstock Logo
Get 15% off with code: VEXELS15

Gear shop adventure logo design

Premiumcrown icon
Editable text
Look at this awesome logo design for a gear shop including a carabiner and a rope! Create your new business logo! Use this logo template and design your own professional logo to place on business cards, social media, your website and more

Everything For You T-shirt Design

for Mercht-shirt icon
Print ready
Nice t-shirt design featuring an illustration of couples mountain climbing with "I do everything for you" caption

Aim high mountain t-shirt design

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

Seven Summits Mountain T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring the seven highest mountain summits

Great Wilderness Quote T-shirt Design

for Mercht-shirt icon
Print ready
T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Bouldering evolution t-shirt design

for Mercht-shirt icon
German Content
Print ready
Awesome design featuring different silhouettes in a mountain landscape, depicting evolution

One arm lock off t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design featuring a climber performing a one-arm lock-off

Munros hiking t-shirt design

for Mercht-shirt icon
Print ready
Beautiful t-shirt design depicting a Munro, a mountain in Scotland with a height over 3,000 feet

Bouldering man sketch t-shirt design

for Mercht-shirt icon
Print ready
Great t-shirt design featuring a man practicing buldering in sketch style

Cute animals on a tree t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Cute t-shirt design featuring a cartoon sloth, panda an monkey climbing on a tree, with the quote "Lebensraum der Tiere"

Colorful baby climber t-shirt design

for Mercht-shirt icon
Print ready
Great t-shirt design featuring a baby climbing a colorful bouldering wall

Retro Camping Logos and Hiking Badges Emblems

Set of 9 nice retro Logo Badges to use for outdoors activities like hiking camping mountaineering climbing and nature adventure

Cat spine t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design that includes various cats climbing on ribs

Rib cage cats t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design featuring a lot of cats climbing up a human ribcage

Mountain Love T-shirt Design

for Mercht-shirt icon
Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Man climbing stairs sequence frames silhouettes

Man climbing stairs sequence frames silhouettes

Let's Get Real High T-shirt Design

for Mercht-shirt icon
Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Mountain Hearbeat Illustration

Mountain Heartbeat design featuring a heartbeat illustration with a mountain in the middle

Mountain climber nature t-shirt design

for Mercht-shirt icon
Print ready
Awesome t-shirt design featuring a person climbing a mountain with trees and a lake in the background

Mountain hiker sloth t-shirt design

for Mercht-shirt icon
Print ready
Awesome t-shirt design that features a hiker sloth and the quote "Slow hikers social club"

Mountain silhouette t-shirt design

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

Rock Climber Quote T-shirt Design

for Mercht-shirt icon
T-shirt design for rock climbers with a quote saying DON'T FOLLOW ME - I DO STUPID THINGS

Hiker and Climber People Silhouette Set

Premiumcrown icon
People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Stroke mountain t-shirt design

for Mercht-shirt icon
Cool mountain theme t-shirt design featuring stroke lines looking like mountain over grunge stripes backdrop

Freaky Hot Climbing Girl

Freaky hot Climbing girl

Mountains Await T-shirt Design

for Mercht-shirt icon
Cool Black and white T-shirt design with a mountain over the clouds illustration

Come Away With Me T-shirt Design

for Mercht-shirt icon
Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

One with the Mountains T-shirt Design

for Mercht-shirt icon
Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Mountains German quote t-shirt design

for Mercht-shirt icon
German Content
Print ready
Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Hacker and climber quote t-shirt design

for Mercht-shirt icon
Editable text
Print ready
Cool t-shirt design featuring a hacker and a climber next to a quote that reads "Hacker by night, climber by day"

Forever a mountaineer t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

Adventure awaits t-shirt design

for Mercht-shirt icon
Simple travel t-shirt design featuring mountain peaks over sky with clouds backdrop in hexagon frame with "Adventure awaits" caption

Mountain label badge template

Label or badge design featuring a mountain silhouette in tones of green and blue

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Forever mountaineer t-shirt design

for Mercht-shirt icon
Print ready
Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Mountain Climber Adventure Lifestyle T-shirt Design

for Mercht-shirt icon
Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Magnolia snake nature t-shirt design

for Mercht-shirt icon
Print ready
Look at this awesome t-shirt design of a green snake climbing up a magnolia! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

6 mountain badge logo templates

Set of mountain labels or badges

Kids Playing Character Pack

Premiumcrown icon
Character pack featuring 4 kids playing and doing different activities

Lion on a planet t-shirt design

for Mercht-shirt icon
Print ready
Check out this awesome t-shirt design of a lion climbing a planet! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Mountain badge logo template set

Label or badge designs featuring mountain silhouettes and slogans

Hipster mountain logo template

Label or logo template design featuring a mountain silhouette in tones of blue and gray

Mountain Silhouette Icon Set

Mountain icon set featuring 16 mountain designs in silhouette style

Mountain badge logo template design

Mountain logo template design featuring a mountain silhouette over a yellow sun

Abstract mountain logo template

Abstract mountain logo template design featuring a blue mountain

2 Outdoors mountain illustration banners or frames

Set of two illustrations featuring forest and mountain landscapes

Retro hiking and camping label badges

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Abstract mountain logo template design

Label or logo design featuring a mountain silhouette in tones of blue and gray

Camping illustrations set

Set of two camping illustrations featuring forest and mountain landscapes

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized
of 3
Boost your businesswith the leading graphic platform for merch
SEE PLANS