Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

1578 mountain designs graphics for t-shirt and print on demand merch

Download mountain t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Cute pink flamingo with surfboard and summer hat illustration t-shirt design PNG Design

Whimsical illustration of a flamingo wearing a hat and holding a surfboard, perfect for summer vibes

Adventurous camping illustration with knife and nature elements PNG Design

Playful poster design featuring a knife, log, and trees, symbolizing outdoor adventures

Adventure-ready jeep sticker design PNG Design

Playful sticker design featuring a rugged jeep among trees, perfect for outdoor enthusiasts

Adventure knife and log badge design PNG Design

Stylized badge design featuring a knife, log, and plant elements, symbolizing outdoor exploration

Adventure knife and wood illustration design PNG Design

Playful t-shirt design featuring a knife embedded in a log, symbolizing adventure

Playful vintage maple syrup bottle design PNG Design

Artistic sun and flower graphic design PNG Design

Playful poster design featuring sun and flower motifs with a creative layered structure

Ski jumper winter sport t-shirt design

Amazing t-shirt design featuring a person skiing down a mountain

Geometric crown and moon illustration PNG Design

Vibrant digital illustration featuring a geometric crown with layered patterns and a crescent moon above

Man with metal detector silhouette t-shirt design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Vintage yellow jeep illustration for adventure lovers PNG Design

Playful sticker design featuring a yellow jeep, highlighting its rugged features and adventurous spirit

Utah Climbing T-shirt Design

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Colorful vintage bottle design with tropical leaves art print PNG Design

Mudding car quote t-shirt design

Awesome t-shirt design featuring a mountain and a car next to a quote that reads "I go mudding"

Minimalist line art of a mother and child in nature PNG Design

Elegant line art design showcasing a mother holding hands with her child, depicting a serene outdoor scene

Gnome cartoon on snowboard t-shirt design

Amazing t-shirt design featuring a gnome snowboarding down a mountain

Stylized monochrome desert scenery with cacti t-shirt design PNG Design

Stylish poster design featuring abstract cacti and rolling hills in a minimalist style

Frog life cycle t-shirt design

Cool t-shirt design that features a simple mountain and the quote "Mount Kosciuzco"

Hill mountain stroke PNG Design

Hill mountain stroke

Winter vacation funny t-shirt design

Amazing t-shirt design featuring a person going down a mountain in the snow and the quote "Paradise doesn't have to be tropical"

Cloudy Mountain Design Set

Design set featuring various mountain ridges

Vintage off-road vehicle graphic design PNG Design

Dynamic sticker design featuring a rugged jeep with bold tires and scenic elements

Pile of books author craft t-shirt design

Stunning t-shirt design featuring a mountain of books with the quote "Write without fear, edit without mercy"

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Dabbing Yeti Sunset Funny Meme T-shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

Snowmobile and mountains t-shirt design

Funny t-shirt design featuring a person with a snowmobile with a mountain and retro sunset background

Retro minimalist landscape t-shirt design

Aesthetic t-shirt design featuring a stylized mountain landscape within a circular frame with the phrase "Into the Wild"

Santa Claus with presents t-shirt design

Awesome t-shirt design that features santa claus driving a car down a mountain with a gift bag and the quote "Santa's special delivery"

Great smoky mountains national park t-shirt design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

Snowboarding sport athlete t-shirt psd

Amazing t-shirt psd that features a person snowboarding with the quote "Snow and mountain"

The melody of the Alps touristic t-shirt design

Check this great t-shirt design including the German quote 'The melody of the Alps' and a mountain man playing an Alps horn

Anime snowboarding t-shirt design

Cool t-shirt design featuring an anime boy character snowboarding down a mountain

Child skying cartoon t-shirt design

Cool t-shirt design featuring a child skying down a mountain in cartoon style

Travel lifestyle line art phone case set

Cool phone case set that features scenes about traveling like a backpack and a mountain

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Colorful strokes Seattle skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

Playful nature-themed water bottle design PNG Design

2015 Year of Goat polygon poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Santa Claus Ski Christmas Background

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Happy camper t-shirt design

Cool camping theme t-shirt design featuring a "Happy camper" caption the A letter is replaced with a tent with various camping elements scattered around Genial diseno de camiseta con tema de acampada con una leyenda "Feliz campista" la letra A se reemplaza por una tienda de campana con varios elementos de acampada esparcidos alrededor O design legal de uma camiseta com o tema camping com a legenda "Campista feliz" a letra A foi substituida por uma barraca com varios elementos de acampamento espalhados ao redor Cooles T-Shirt-Design zum Thema Camping mit der Aufschrift "Happy Camper"

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Vintage camping water bottle illustration with nature elements PNG Design

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Faith can move mountains Christian quote PNG Design

A majestic mountain range stands tall as the sun begins to set, with rays of light shining through the clouds, depicting the power of faith

Daring my way to christmas PNG Design

A person bravely snowboarding down a steep mountain covered in snow, decked out in Christmas decorations and lights

Boost your businesswith the leading graphic platform for merch