Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

425 hiking designs graphics for t-shirt and print on demand merch

Download hiking t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Playful camping mug design with tree illustration PNG Design

Cheerful digital artwork featuring a yellow camping mug with a tree graphic

Stylish tribal boot print design PNG Design

Unique boot print design showcases intricate tribal patterns for footwear aesthetics

Oil lamp design featuring scenic mountain illustration PNG Design

Charming illustration in a lantern showing mountains and a sun motif

Colorful mountain scene mug design PNG Design

Playful illustration featuring a yellow mug with a tree symbol, surrounded by mountains and greenery

Adventure sports zipline design PNG Design

Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Colorful lantern with scenic landscape design PNG Design

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Charming winter boots illustration PNG Design

Playful graphic design of winter boots featuring fluffy cuffs and buckles

Bold military-style boots illustration design PNG Design

Bold illustration of combat boots featuring intricate lacing and detailed textures

Olympic national park quote t-shirt design

Awesome t-shirt design featuring pine trees over a mountain and the quote "Winter hiking warms my soul"

Camping icons and elements

Camping is one big way of enjoy life outdoors

Mountain lake flat landscape

Beautiful mountains landscape with turquoise lake pine tree forest hills cloudy sky snowed peaks and aero-static globe

Detailed lantern illustration with mountain landscape PNG Design

Unique lantern design featuring a scenic mountain landscape inside

Mountain Love T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Boy on Rock Landscape T-shirt Design

T-shirt design featuring a boy on top of a rock holding a balloon

Playful footwear graphic design PNG Design

Whimsical design featuring stylized legs in boots, creating a fun and quirky look

Let's Get Real High T-shirt Design

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Playful camping mug illustration with tree design PNG Design

Charming illustration featuring a yellow camping mug with a tree symbol, highlighting outdoor adventure themes

Cozy winter boots illustration PNG Design

Charming illustration of winter boots, featuring a soft fur top and detailed laces

Stylish vintage boot illustration PNG Design

Unique vintage boot design showcasing intricate lacing and detailed contours

Winter mountain landscape illustration

Flat illustration featuring a field with some trees and mountains on the horizon

Flat mountain woods landscape

Flat landscape illustration featuring lots of mountains and woods

Stylish red footprint design PNG Design

Dynamic footprint design featuring bold red soles and striking star patterns

Mountains Calling T-shirt Design

Cool t-shirt design showing a badge with mountains illustration and "Mountains Are Calling" caption

Detailed combat boot illustration PNG Design

Sturdy boot design featuring intricate lacing details and a robust style

Mountain Silhouette Icon Set

Forest landscape with tall trees

Illustration featuring a pine tree forest viewed from the ground

Flat mountain landscape design

Flat winter landscape illustration featuring lots of mountains snow and woods

Mountain climbing silhouette icon PNG Design

Mountains Await T-shirt Design

Cool Black and white T-shirt design with a mountain over the clouds illustration

Isolated mountain illustration set

Set of mountain illustrations in different shapes and tones

Flat nature landscape design

Flat landscape illustration featuring lots of hills fields and woods

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Green forest landscape with deer

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Flat forest landscape illustration

Flat landscape illustration featuring a forest mountain and river

Set of isolated mountain illustrations

Set of mountain illustrations in different tones and shapes

Calm field landscape illustration

Flat illustration featuring a field with some hills on the horizon

Flat camping illustration

Flat illustration featuring a camping on a forest with a tent campfire and other details

Identification Of Practical Common Vector

Identification of practical common vector image in

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Camping landscape illustration with campfire

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Forest and mountains landscape with deer

Flat landscape illustration featuring lots of trees mountains and a deer

Sports Silhouette Collecton

Huge collection of various sports silhouettes

Mountain with snow landscape illustration

Flat winter landscape illustration featuring lots of mountains snow and some woods

Camping survival kit

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

Adventure Awaits Outdoor Experience T-shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Sunrise on the mountains illustration

Low poly illustration featuring moutains and the sun rays coming through them

Forest sunset illustration landscape

Flat landscape illustration featuring a forest with light coming through the tree branches

One with the Mountains T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Mountain landscape illustration design

Flat illustration featuring moutains and their reflection

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

of 9

Boost your businesswith the leading graphic platform for merch