Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

1576 mountain Graphics and Designs

Mountain Graphics to download

Sponsored results by Shutterstock Logo

Get 15% off with code: VXL15

Geometric crown and moon illustration PNG Design

Vibrant digital illustration featuring a geometric crown with layered patterns and a crescent moon above

Adventure-ready jeep sticker design PNG Design

Playful sticker design featuring a rugged jeep among trees, perfect for outdoor enthusiasts

Playful vintage maple syrup bottle design PNG Design

Vintage off-road vehicle graphic design PNG Design

Dynamic sticker design featuring a rugged jeep with bold tires and scenic elements

Vintage yellow jeep illustration for adventure lovers PNG Design

Playful sticker design featuring a yellow jeep, highlighting its rugged features and adventurous spirit

Ski jumper winter sport t-shirt design

Amazing t-shirt design featuring a person skiing down a mountain

Colorful vintage bottle design with tropical leaves art print PNG Design

Man with metal detector silhouette t-shirt design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Utah Climbing T-shirt Design

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Minimalist line art of a mother and child in nature PNG Design

Elegant line art design showcasing a mother holding hands with her child, depicting a serene outdoor scene

Mudding car quote t-shirt design

Awesome t-shirt design featuring a mountain and a car next to a quote that reads "I go mudding"

Stylized monochrome desert scenery with cacti t-shirt design PNG Design

Stylish poster design featuring abstract cacti and rolling hills in a minimalist style

Gnome cartoon on snowboard t-shirt design

Amazing t-shirt design featuring a gnome snowboarding down a mountain

Hill mountain stroke PNG Design

Hill mountain stroke

Frog life cycle t-shirt design

Cool t-shirt design that features a simple mountain and the quote "Mount Kosciuzco"

Cloudy Mountain Design Set

Design set featuring various mountain ridges

Winter vacation funny t-shirt design

Amazing t-shirt design featuring a person going down a mountain in the snow and the quote "Paradise doesn't have to be tropical"

Pile of books author craft t-shirt design

Stunning t-shirt design featuring a mountain of books with the quote "Write without fear, edit without mercy"

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Dabbing Yeti Sunset Funny Meme T-shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

Snowmobile and mountains t-shirt design

Funny t-shirt design featuring a person with a snowmobile with a mountain and retro sunset background

Retro minimalist landscape t-shirt design

Aesthetic t-shirt design featuring a stylized mountain landscape within a circular frame with the phrase "Into the Wild"

Santa rocket sleigh background

This is indeed a cool Christmas background: Santa Claus in cartoon style descending a snowy mountain in his powerful rocket sleigh

Great smoky mountains national park t-shirt design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

Santa Claus with presents t-shirt design

Awesome t-shirt design that features santa claus driving a car down a mountain with a gift bag and the quote "Santa's special delivery"

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

Anime snowboarding t-shirt design

Cool t-shirt design featuring an anime boy character snowboarding down a mountain

Snowboarding sport athlete t-shirt psd

Amazing t-shirt psd that features a person snowboarding with the quote "Snow and mountain"

The melody of the Alps touristic t-shirt design

Check this great t-shirt design including the German quote 'The melody of the Alps' and a mountain man playing an Alps horn

Travel lifestyle line art phone case set

Cool phone case set that features scenes about traveling like a backpack and a mountain

Halloween Night Party Poster with Hunted House & Dead Trees

Halloween the horror night party poster template contains a hunted house placed at the very top of the large mountain

Colorful strokes Seattle skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

Child skying cartoon t-shirt design

Cool t-shirt design featuring a child skying down a mountain in cartoon style

2015 Year of Goat polygon poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Santa Claus Ski Christmas Background

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Playful nature-themed water bottle design PNG Design

Happy camper t-shirt design

Cool camping theme t-shirt design featuring a "Happy camper" caption the A letter is replaced with a tent with various camping elements scattered around Genial dise?o de camiseta con tema de acampada con una leyenda "Feliz campista" la letra A se reemplaza por una tienda de campa?a con varios elementos de acampada esparcidos alrededor O design legal de uma camiseta com o tema camping com a legenda "Campista feliz" a letra A foi substitu?da por uma barraca com v?rios elementos de acampamento espalhados ao redor Cooles T-Shirt-Design zum Thema Camping mit der Aufschrift "Happy Camper"

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Vintage camping water bottle illustration with nature elements PNG Design

Faith can move mountains Christian quote PNG Design

A majestic mountain range stands tall as the sun begins to set, with rays of light shining through the clouds, depicting the power of faith

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Daring my way to christmas PNG Design

A person bravely snowboarding down a steep mountain covered in snow, decked out in Christmas decorations and lights

Jeep with the words always chasing freedom PNG Design

A rugged Jeep sits atop a mountain, with the words "always chasing freedom" written in bold letters on its side

Industrial Cityscape Silhouettes

Set of 3 different cityscape silhouettes depicts industrial mountain view and skyline scenes

2 Chinese New Year banners

This February 19th is the celebration of Chinese New Year join to this great day with these two banners: the first shows a Chinese temple on the top of a mountain some decorative hanging balls and leaves around; the second has several decorative hanging balls spots of light and glitters

Boost your businesswith the leading graphic platform for merch