Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

142 climbing Vectors & Graphics to Download

Download climbing editable vector graphics for every design project. In AI, SVG, PNG, JPG and PSD.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Mountain climbing silhouettes set

Mountain climbing silhouettes set

People climbing silhouettes sport set

Awesome sport-themed set that features a series of silhouettes of people climbing

Mountain climbing t-shirt design

T-shirt design featuring the silhouette of someone climbing a mountain

Climbing wall seamless pattern

Tileable pattern

Cool seamless pattern that resembles a rock climbing wall

Climbing silhouette set

Awesome set design that features four people climbing in silhouette style

Playground climbing frame illustration

Colorful kids playground illustration of play towers with slides and climbing frame

Climbing motivation metaphor

Rock climbing girl with beautiful twilight sundown on the background

Climbing equipment ropes and walnuts hobby set

Awesome hobby-themed set that features a series of climbing equipment in blue, red, purple, orange and green

Climbing colorful design

This vectors shows a young man climbing on a limesonte wall with colorful abstract design

Man climbing stairs sequence frames silhouettes

Man climbing stairs sequence frames silhouettes

Freaky Hot Climbing Girl

Freaky hot Climbing girl

Mountain Silhouette Icon Set

Retro hiking and camping label badges

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Retro Camping Logos and Hiking Badges Emblems

Rock Mountain Or Hill Climibing clip art

Abstract black and white style artwork of a male character climbing rock mountain

Mountain climbing nature logo template

Full Branding Kit

Mountain label badge template

Label or badge design featuring a mountain silhouette in tones of green and blue

6 mountain badge logo templates

Hiker and Climber People Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Mountain badge logo template set

Action Fireman Poses

Various vector designs in this set depicting a fireman in action poses

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

6 Extreme sports badges

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Mountain Hearbeat Illustration

Mountain Heartbeat design featuring a heartbeat illustration with a mountain in the middle

Hipster mountain logo template

Diving and alpinism banners

Flat silhouette style of banners: diving and alpinism in plain colors

Abstract mountain logo template

Men Trekking Mountain

Beautiful looking picture depicts a couple of men trekking mountains over abstract colorful sunrise sky in the background

Camping illustrations pack

Set of two camping illustrations featuring forest and mountain landscapes

Mountain badge logo template design

2 Outdoors mountain illustration banners or frames

Set of two illustrations featuring forest and mountain landscapes

Abstract mountain logo template design

28 Sport silhouettes square icons

This set has 28 icons of many different sports represented as silhouettes within yellow squares

Camping illustrations set

Set of two camping illustrations featuring forest and mountain landscapes

Illustrated camping set

Set of two camping illustrations featuring mountain and forest landscapes

Outdoor landscapes illustration set

Set of two illustrations featuring a forest and icy mountain landscape

30 Sport circle icons

This set has 30 icons of many different sports represented as silhouettes within colored circles

Sports

Sports Deportes Esportes Sport

Vacations Travel photos background

Background with several photos of landmarks and landscapes around the world placed over a parchment

Mountain label logo template

2 outdoors forest illustration banners or frames

Set of two camping illustrations featuring forest landscapes

Mountain label logo design

Photojournalist with pictures around the world

Female photojournalist with pictures around the world

Kids Playing Character Pack

Character pack featuring 4 kids playing and doing different activities

Mountain logo template design

Mountain label logo template design

Gear shop adventure logo design

Flat hiking landscape illustration

Flat landscape illustration featuring lots of trees mountains and a hiker climbing some rocks

Crossfit silhouette set

Collection of people silhouettes doing crossfit featuring men and women lifting weights climbing rope doing push-ups pull-ups gymnastics and other exercises Coleccion de siluetas de personas haciendo crossfit con hombres y mujeres que levantan pesas escalan la cuerda hacen flexiones flexiones gimnasia y otros ejercicios

of 3

Boost your businesswith the leading graphic platform for merch