Design Library

Design Tools

Resources

Corporate Solutions

Sign Up

Log in

213 mountain hiking designs graphics for t-shirt and print on demand merch

Download mountain hiking t-shirt designs and other merch graphics like book covers, phone cases, tote bags and more.

Sponsored results by Shutterstock Logo

Get 15% off with code: VEXELS15

Playful vintage maple syrup bottle design PNG Design

Retro hiking and camping label badges

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Dog Trekking T-shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Mountains Await T-shirt Design

Cool Black and white T-shirt design with a mountain over the clouds illustration

Mountains German quote t-shirt design

Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Hiker and Climber People Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Forever mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Flat forest landscape illustration

Flat landscape illustration featuring a forest mountain and river

Let's Get Real High T-shirt Design

Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Men Trekking Mountain

Beautiful looking picture depicts a couple of men trekking mountains over abstract colorful sunrise sky in the background

Mountains resort logo PNG Design

Mountains stroke icon PNG Design

The walking gnome PNG Design

The walking gnome

Adventure sports zipline design PNG Design

Dynamic t-shirt design featuring a silhouette of a zipliner amidst scenic hills and a stylized sunset

Vintage inspired nature-themed bottle illustration PNG Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

Adventure Awaits Outdoor Experience T-shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Colorful camping backpack illustration with sunset background design PNG Design

Stylized patch design featuring a detailed hiking backpack with rolled sleeping mat

Sunrise on the mountains illustration

Low poly illustration featuring moutains and the sun rays coming through them

Camping badges

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Come Away With Me T-shirt Design

Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Colorful lantern with scenic landscape design PNG Design

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Mountains journey logo PNG Design

Playful vintage bottle design with nature elements PNG Design

Charming bottle illustration featuring a unique design, accented with natural motifs

Camping illustrations set

Set of two camping illustrations featuring forest and mountain landscapes

Colorful camping tent graphic with nature elements t-shirt design PNG Design

Playful graphic design featuring a colorful tent with tree silhouettes, perfect for camping enthusiasts

Colorful nature-inspired bottle illustration design PNG Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Camping illustrations pack

Set of two camping illustrations featuring forest and mountain landscapes

Playful nature-themed water bottle design PNG Design

Adventure knife and wood illustration design PNG Design

Playful t-shirt design featuring a knife embedded in a log, symbolizing adventure

Outdoor landscapes illustration set

Set of two illustrations featuring a forest and icy mountain landscape

Vintage style potion bottle illustration PNG Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Illustrated camping set

Set of two camping illustrations featuring mountain and forest landscapes

Colorful vintage bottle design with tropical leaves art print PNG Design

Landscape Badge Design Pack

Badge design pack featuring two landscape design badges including natural landscapes

Vintage camping water bottle illustration with nature elements PNG Design

Playful vintage style bottle design PNG Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Nature Landscape Badge Pack

Badge pack featuring two nature landscape designs namely a tropical island seen from the sea and a hut between mountains

Vintage style bottle badge design PNG Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Stylized vintage bottle illustration PNG Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Extreme Sports Silhouette Collection

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Mountain Vectors

Free mountain vectors illustration in adobe illustrator

Camping icons and elements

Camping is one big way of enjoy life outdoors

Camping badge

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

One with the Mountains T-shirt Design

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Winter landscape with snow and trees

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Camping survival kit

This amazing set of camping survival kit has a collection of the most important elements for camping and hiking world

Snow and mountains illustrated landscape

Flat illustration featuring a winter landscape with mountains trees and lots of snow

Boy on Rock Landscape T-shirt Design

T-shirt design featuring a boy on top of a rock holding a balloon

Winter snow landscape illustration

Winter illustration featuring a winter landscape with mountains trees a river and lots of snow

Forever a mountaineer t-shirt design

Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

of 5

Boost your businesswith the leading graphic platform for merch